Align Inner-membrane translocator (characterized, see rationale)
to candidate AZOBR_RS31200 AZOBR_RS31200 sugar ABC transporter permease
Query= uniprot:A0KWY7 (320 letters) >FitnessBrowser__azobra:AZOBR_RS31200 Length = 325 Score = 358 bits (918), Expect = e-103 Identities = 179/306 (58%), Positives = 231/306 (75%) Query: 5 RFIPLWITASLLLTMFLVGTFQFDGFASGRVVTNLLRDNAFLLITALGMTLVIISGGIDL 64 RF+PL +T+++L+ FL+ QF FAS RVV NLL DNAFL ITA+GMT VI+SGGIDL Sbjct: 4 RFLPLLVTSAVLVVGFLLCAAQFPNFASLRVVGNLLTDNAFLGITAVGMTFVILSGGIDL 63 Query: 65 SVGAVIALSGVVTSLLITEYQWHPLLAFVVILPLGTLFGALMGTIIHVYKLQPFIVTLAG 124 SVGAVI + V+ ++LI + WHP+ AF V L + FGA MG +IHV+++ PFIVTLAG Sbjct: 64 SVGAVIGFTTVLLAVLIEQGGWHPVSAFAVALAVAGGFGAAMGAVIHVFQMPPFIVTLAG 123 Query: 125 MFLARGLATTLSEESIAIDHPFYDAVAEMSIALPGNGALDLSSLIFILFFVIIAVVMHYT 184 MF+ARGL LS +SI I+HP Y + ++++ G G L L +L+ + V H+T Sbjct: 124 MFVARGLGFVLSTDSIPINHPLYAELGDLALRFDGGGKLTLPALLMLGVVAAAVVCAHWT 183 Query: 185 RFGTNVYAIGGNQHSAELMGISIAKTTISIYAISSFLATLAGIVFTFYTFSGYALGAIGV 244 RFG N+YA+GGN+ SAELMG+ + +TT+++YA+S LA LAGIVF+ YT +GY+L A GV Sbjct: 184 RFGANLYALGGNRQSAELMGVPVGRTTVAVYALSGLLAGLAGIVFSLYTGAGYSLAATGV 243 Query: 245 ELDAIAAVVIGGTLLTGGSGFVLGTVLGVILMGVIQTYITFDGSLSSWWTKIVIGLLLFF 304 ELD I AVVIGGT LTGG G+V+GT +GV++ G+IQTYITFDGSLSSWWTKI IG+LLF Sbjct: 244 ELDTITAVVIGGTQLTGGYGYVIGTFIGVLIQGLIQTYITFDGSLSSWWTKIAIGVLLFV 303 Query: 305 FILLQK 310 FILLQK Sbjct: 304 FILLQK 309 Lambda K H 0.330 0.145 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 23 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 325 Length adjustment: 28 Effective length of query: 292 Effective length of database: 297 Effective search space: 86724 Effective search space used: 86724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory