Align L-arabinose 1-dehydrogenase (NAD(P)(+)); D-galactose 1-dehydrogenase; EC 1.1.1.376; EC 1.1.1.120; EC 1.1.1.48 (characterized)
to candidate AZOBR_RS29845 AZOBR_RS29845 oxidoreductase
Query= SwissProt::Q53TZ2 (309 letters) >FitnessBrowser__azobra:AZOBR_RS29845 Length = 342 Score = 61.2 bits (147), Expect = 3e-14 Identities = 79/265 (29%), Positives = 107/265 (40%), Gaps = 17/265 (6%) Query: 7 LGVVGIGKIARDQHLPAIDAEPGFKLTACASRHAEVTGVRNYR-DLRALLAAERELD--- 62 +GV+G+G A +D ++ C S AE R L A+ AE LD Sbjct: 5 VGVIGLGMAATPHAQSLLDLADRVEVAGCFSPSAERRAAFAARFGLPAVDRAEAILDDPT 64 Query: 63 --AVSLCAPPQVRYAQARAALEAGKHVMLEKPPGAT-LGEVAVLEALARERGLTLFATWH 119 AV L PP AGKHV+LEKP AT G AV+E++ R GLTL Sbjct: 65 VSAVLLLTPPDTHADLVARCAAAGKHVLLEKPLDATPAGCRAVVESMER-AGLTLGVMLQ 123 Query: 120 SRCASAVEPAREWLATRAI-----RAVQVR-WKEDVRRWHPGQQWIWEPGGLGVFDPGIN 173 R +A E E L T + +V VR W++D PG+ GG + I+ Sbjct: 124 HRFRAAAERLAELLRTGTLGRPLSASVVVRWWRDDAYYAQPGRGMKARDGGGVLLTQAIH 183 Query: 174 ALSIVTRI--LPREL-VLREATLIVPSDVQTPIAAELDCADTDGVPVRAEFDWRHGPVEQ 230 L + + LPRE+ + + P D + + A L V A G E+ Sbjct: 184 TLDLYVSLLGLPREVAAFANTSGLRPIDTEDVVCAALRYDGGLLATVDATTAAYPGYPER 243 Query: 231 WEIAVDTADGVLAISRGGAQLSIAG 255 EIA +L R QL G Sbjct: 244 IEIAGTAGSALLTGDRLEVQLRSGG 268 Lambda K H 0.321 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 342 Length adjustment: 28 Effective length of query: 281 Effective length of database: 314 Effective search space: 88234 Effective search space used: 88234 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory