Align N-carbamoylputrescine amidase; EC 3.5.1.53 (characterized)
to candidate AZOBR_RS30770 AZOBR_RS30770 carbon-nitrogen hydrolase
Query= SwissProt::Q9XGI9 (300 letters) >FitnessBrowser__azobra:AZOBR_RS30770 Length = 268 Score = 91.7 bits (226), Expect = 2e-23 Identities = 80/273 (29%), Positives = 124/273 (45%), Gaps = 27/273 (9%) Query: 24 NVATAERLVRAAHQKGANIILIQELFEGYYFCQAQKEEFFHRAKPYPGHPTIVRMQNLAK 83 N+ ER A ++G +++ E+ Y A+ A+P G P R+ +A+ Sbjct: 18 NLDRLERAAAEAAERGPALLVGPEMGLTSYDIGAETVRAL--AEPVDG-PMAARVAEIAR 74 Query: 84 ELGVVIPVSFFEE-ANNAHYNSVAIIDADGTDLGLYRKSHIPDGPGYQEKYYFNPGDTGF 142 G+ I + E A+ A YN+ +I +DG L RK+H+ G ++ F PG F Sbjct: 75 RHGIAILYGYPERGADGAVYNAAQLIGSDGQSLLNQRKTHLY---GDLDRGSFAPGGDAF 131 Query: 143 KVFQTKYAKIGVAICWDQWFPEAARAMALQGAEVLFYPTAIGSEPQDDGLDSRDHWRRVM 202 + ++GVAIC+D FPE R AL G +VL PTA+ + + V+ Sbjct: 132 PTAEVDGMRVGVAICYDVEFPELVRRHALAGVDVLLVPTALMTPYEIVA-------TTVI 184 Query: 203 QGHAGANVVPLVASNRIGKEIIETEHGNSEITFYGYSFIAGPTGELVAAAGDKEEAVLVA 262 A N + + +NR G+E + + G S +A P G ++A AGD EA+L Sbjct: 185 PARAFENGIFVAYANRCGRE--------GTLRYCGLSSVAAPDGSVLARAGD-GEALLTV 235 Query: 263 QFDLDKIKSKRHGWGVYRDRRPDLYKVLLTLDG 295 D + H DRRPDLY + + G Sbjct: 236 DLDAALRRVGTH----LADRRPDLYGAVSSTPG 264 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 268 Length adjustment: 26 Effective length of query: 274 Effective length of database: 242 Effective search space: 66308 Effective search space used: 66308 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory