GapMind for catabolism of small carbon sources

 

Aligments for a candidate for arcA in Azospirillum brasilense Sp245

Align arginine deiminase (EC 3.5.3.6) (characterized)
to candidate AZOBR_RS13255 AZOBR_RS13255 arginine deiminase

Query= BRENDA::P13981
         (418 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS13255 AZOBR_RS13255 arginine
           deiminase
          Length = 409

 Score =  531 bits (1369), Expect = e-155
 Identities = 254/411 (61%), Positives = 321/411 (78%), Gaps = 6/411 (1%)

Query: 6   TKLGVHSEAGKLRKVMVCSPGLAHQRLTPSNCDELLFDDVIWVNQAKRDHFDFVTKMRER 65
           +++GVHSE GKLR V+VC P LAHQRLTP NC +LLFDDVIWV++A++DH D V KM ER
Sbjct: 2   SEVGVHSEVGKLRTVLVCRPSLAHQRLTPGNCHDLLFDDVIWVHEAQKDHHDLVLKMEER 61

Query: 66  GIDVLEMHNLLTETIQNPEALKWILDRKITADSVGLGLTSELRSWLESLEPRKLAEYLIG 125
           G++VL++H+LL +T+ +P+A +++LDR++TA++VG+     +R WL+ +  R+LA +LIG
Sbjct: 62  GVEVLDLHDLLAQTLDDPQARRFVLDRRVTANTVGVAAVEVMRPWLDEMPSRELAVHLIG 121

Query: 126 GVAADDLPASEGANILKMYREYLGHSSFLLPPLPNTQFTRDTTCWIYGGVTLNPMYWPAR 185
           G+A  DLP +  + +L    E  G + F+LPP+PNT F RD +CWIY GVT NPM+WPAR
Sbjct: 122 GIAISDLPDNTVSVLLN---EAFGGTDFVLPPIPNTLFQRDPSCWIYNGVTCNPMFWPAR 178

Query: 186 RQETLLTTAIYKFHPEFANAEFEIWYGDPDKDHGSSTLEGGDVMPIGNGVVLIGMGERSS 245
           + ETLL  A+YKFHP F +  F IW+GD D+D   ++LEGGDVMPIG GVVLIGMGER++
Sbjct: 179 KPETLLQRAVYKFHPRFRDGGFTIWWGDSDEDFTGASLEGGDVMPIGKGVVLIGMGERTN 238

Query: 246 RQAIGQVAQSLFAKGAAERVIVAGLPKSRAAMHLDTVFSFCDRDLVTVFPEVVKEIVPFS 305
           RQA+GQV ++LF   AA RVI   +PKSRAAMHLDTVFSFCDRDLVTVF EVV +I  +S
Sbjct: 239 RQAVGQVTRALFRNNAASRVIACLMPKSRAAMHLDTVFSFCDRDLVTVFREVVDQIRCYS 298

Query: 306 LRP-DPSSPYGMNIRREEKTFLEVVAESLGLKKLRVVETGGNSFAAEREQWDDGNNVVCL 364
             P D    +   +R E +  LEVVA++LG  +LR+V TGGN++ AEREQWDDGNNVV L
Sbjct: 299 AYPLDDEGRF--EVRPEARPLLEVVADALGYSRLRIVGTGGNAYEAEREQWDDGNNVVAL 356

Query: 365 EPGVVVGYDRNTYTNTLLRKAGVEVITISASELGRGRGGGHCMTCPIVRDP 415
           EPGVVV YDRNTYTNTLLRKAGVEVIT+  +ELGRGRGGGHCMTCPI R+P
Sbjct: 357 EPGVVVAYDRNTYTNTLLRKAGVEVITVRGAELGRGRGGGHCMTCPIWREP 407


Lambda     K      H
   0.319    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 563
Number of extensions: 19
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 418
Length of database: 409
Length adjustment: 31
Effective length of query: 387
Effective length of database: 378
Effective search space:   146286
Effective search space used:   146286
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory