GapMind for catabolism of small carbon sources

 

Aligments for a candidate for arcB in Azospirillum brasilense Sp245

Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate AZOBR_RS19030 AZOBR_RS19030 ornithine carbamoyltransferase

Query= BRENDA::Q98BB6
         (303 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS19030 AZOBR_RS19030 ornithine
           carbamoyltransferase
          Length = 304

 Score =  357 bits (916), Expect = e-103
 Identities = 180/302 (59%), Positives = 216/302 (71%), Gaps = 2/302 (0%)

Query: 2   SVRHFTDLSTVSEGDLRFMLDDAVVRKARLKAGERTRPLEGKVLAMIFDKPSTRTRVSFD 61
           +VRHF D+  + +  LR +L  A   K  + A        G+ LAMIF+KPSTRTRVSF+
Sbjct: 3   AVRHFLDIDRLDKATLRQILAMAATIKKDIPAYRSL--FAGRTLAMIFEKPSTRTRVSFE 60

Query: 62  VGMRQLGGETIMLTGTEMQLGRSETIADTAKVLSRYVDAIMIRTTSHDRLLELTENATVP 121
           VGMRQLGG+ ++L   +MQLGR ETI DTA+VLSRYVDA+M+RT   +R+ EL E A+VP
Sbjct: 61  VGMRQLGGDVVVLKPDDMQLGRGETIGDTARVLSRYVDAVMVRTMGEERVHELAEFASVP 120

Query: 122 VINGLTDDTHPCQLMADIMTFEEHRGPVAGKTIAWTGDGNNVLHSLLEASARFRFNLNVA 181
           +INGLTD +HPCQ+MAD+MTFEEHRGP+ G+T+AW GD NNV  S +  + R    + + 
Sbjct: 121 IINGLTDQSHPCQIMADVMTFEEHRGPIEGRTVAWIGDVNNVAVSWVHVAVRLGVEIRLG 180

Query: 182 VPEGSEPAQKHIDWSKAHGGKLHFTRSPEEAVDQADCVVTDCWVSMGQEHRARGHNVFSP 241
            PE   PA + +DW K  GG++  T SPEEAV  ADCVVTD W SM          V  P
Sbjct: 181 CPEIYGPAPELLDWVKREGGRITVTTSPEEAVRGADCVVTDAWASMHNTDVDERAAVLGP 240

Query: 242 YQVNAKLMAHAKPDALFMHCLPAHRGEEVTDEVIDGPHSVVFDEAENRLHAQKAVLAWCL 301
           YQVN  LMA A PDALFMHCLPAHRGEEVTD VIDG HSVV+DEAENRLHAQKA+LAWCL
Sbjct: 241 YQVNEALMALAAPDALFMHCLPAHRGEEVTDGVIDGRHSVVWDEAENRLHAQKAILAWCL 300

Query: 302 GA 303
           GA
Sbjct: 301 GA 302


Lambda     K      H
   0.320    0.133    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 361
Number of extensions: 14
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 303
Length of database: 304
Length adjustment: 27
Effective length of query: 276
Effective length of database: 277
Effective search space:    76452
Effective search space used:    76452
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate AZOBR_RS19030 AZOBR_RS19030 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00658.hmm
# target sequence database:        /tmp/gapView.24072.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00658  [M=304]
Accession:   TIGR00658
Description: orni_carb_tr: ornithine carbamoyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   1.7e-117  377.9   0.0   1.9e-117  377.7   0.0    1.0  1  lcl|FitnessBrowser__azobra:AZOBR_RS19030  AZOBR_RS19030 ornithine carbamoy


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__azobra:AZOBR_RS19030  AZOBR_RS19030 ornithine carbamoyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  377.7   0.0  1.9e-117  1.9e-117       1     303 [.       5     300 ..       5     301 .. 0.98

  Alignments for each domain:
  == domain 1  score: 377.7 bits;  conditional E-value: 1.9e-117
                                 TIGR00658   1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvl 69 
                                               rh+l++  l+++ l+++l +a+++kk+  +   ++ + g+tla+iFek+stRtRvsfev++ +lG+ v+
  lcl|FitnessBrowser__azobra:AZOBR_RS19030   5 RHFLDIDRLDKATLRQILAMAATIKKDIPA--YRSLFAGRTLAMIFEKPSTRTRVSFEVGMRQLGGDVV 71 
                                               8*************************9988..6889********************************* PP

                                 TIGR00658  70 ylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDllt 138
                                               +l+++++qlgr+e+i Dtarvlsryvda++vR++ +e v+ela++asvP+ingLtd++hPcqi+aD++t
  lcl|FitnessBrowser__azobra:AZOBR_RS19030  72 VLKPDDMQLGRGETIGDTARVLSRYVDAVMVRTMGEERVHELAEFASVPIINGLTDQSHPCQIMADVMT 140
                                               ********************************************************************* PP

                                 TIGR00658 139 ikeklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggklelt 207
                                                +e+ g +++ +++++GD nnva s +  a+ lG+++++ +Pe + p +e++++     k++gg++++t
  lcl|FitnessBrowser__azobra:AZOBR_RS19030 141 FEEHRGPIEGRTVAWIGDVNNVAVSWVHVAVRLGVEIRLGCPEIYGPAPELLDWV----KREGGRITVT 205
                                               ****************************************************998....67******** PP

                                 TIGR00658 208 edpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdev 276
                                                 p++av++ad ++tD w+sm + +  +er ++l pyqvne l++la p++ f+hCLPa+rGeevtd v
  lcl|FitnessBrowser__azobra:AZOBR_RS19030 206 TSPEEAVRGADCVVTDAWASMHNTD-VDERAAVLGPYQVNEALMALAAPDALFMHCLPAHRGEEVTDGV 273
                                               *********************8765.669**************************************** PP

                                 TIGR00658 277 legeasivfdeaenRlhaqkavlkall 303
                                               ++g++s+v+deaenRlhaqka+l+++l
  lcl|FitnessBrowser__azobra:AZOBR_RS19030 274 IDGRHSVVWDEAENRLHAQKAILAWCL 300
                                               ***********************9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (304 nodes)
Target sequences:                          1  (304 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 8.00
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory