Align Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94) (characterized)
to candidate AZOBR_RS07460 AZOBR_RS07460 anthranilate synthase
Query= reanno::pseudo5_N2C3_1:AO356_13140 (258 letters) >FitnessBrowser__azobra:AZOBR_RS07460 Length = 196 Score = 57.8 bits (138), Expect = 2e-13 Identities = 51/157 (32%), Positives = 69/157 (43%), Gaps = 24/157 (15%) Query: 77 QGPASAPGTAHDPARDATTLPLIRAAVEAGVPVLGICRGFQEMNVAFGGSLHQKVHEVGT 136 +G +PG DP + LPLI AA +AGVP++G+C G Q + AFGG++ Sbjct: 45 EGIVLSPGPC-DPDKAGICLPLIDAAAKAGVPLMGVCLGHQAIGQAFGGTV--------- 94 Query: 137 FIDHREDDTQAVEVQYGPAHAVDIQPGGILAGLGLPQSIEVNSIHSQGIER--LAPGLRA 194 +A +G + Q G+L LP HS +ER L L Sbjct: 95 --------LRAPVPMHGKVDRMFHQGRGVLK--DLPSPFRATRYHSLIVERATLPACLEV 144 Query: 195 EAVAPDGLIEAVSVPEGKAFALGVQWHPEWEVSSNPH 231 DGLI A+S E GVQ+HPE S + H Sbjct: 145 TGETEDGLIMALSHCELPIH--GVQFHPESIESEHGH 179 Lambda K H 0.318 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 196 Length adjustment: 22 Effective length of query: 236 Effective length of database: 174 Effective search space: 41064 Effective search space used: 41064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory