Align arginase subunit (EC 3.5.3.1) (characterized)
to candidate AZOBR_RS19585 AZOBR_RS19585 arginase
Query= metacyc::MONOMER-11552 (324 letters) >FitnessBrowser__azobra:AZOBR_RS19585 Length = 315 Score = 325 bits (833), Expect = 9e-94 Identities = 168/308 (54%), Positives = 214/308 (69%), Gaps = 10/308 (3%) Query: 22 QILGAPVQSGASQPGCLMGPDAFRTAGLTQVLTELGWAVTDLGDA-----TPTVEPELSH 76 +I+G P+++GA PG LMGP A RTAGL + L ELG V DLGD TP S Sbjct: 2 EIIGVPIEAGAGHPGALMGPAALRTAGLVRALRELGHEVRDLGDLGRGDLTPA---PWSE 58 Query: 77 PNSAVKNLDALVGWTRSLSQKALEMARSCDLPVFLGGDHSMSAGTVSGVAQRTAELGKEQ 136 ++A L + W+R+L+ ++ M ++ +PVFLGGDHS+S G+V+GVA+ E GK Sbjct: 59 GDAATARLAEITAWSRALADRSYAMMQAGGVPVFLGGDHSLSMGSVTGVARHCRETGKPL 118 Query: 137 FVLWLDAHTDLHTLHTTASGNLHGTPVAYYTGQSGFEGL--PPLAAPVNPRNVSMMGIRS 194 FVLWLDAH D +T HT+ SGN+HG PVA G+ GF+ + P A VNP +V + GIRS Sbjct: 119 FVLWLDAHGDFNTPHTSPSGNMHGMPVALLCGEDGFDNVFPPEQRATVNPAHVHLFGIRS 178 Query: 195 VDPEERRRVAEIGVQVADMRVLDEQGVVRPLEAFLDRVSKVSGRLHVSLDVDFLDPAIAP 254 +DP ERR + GV V DMR++DE GV + ++RV + G LHVSLDVDFLDPAIAP Sbjct: 179 LDPGERRLLRARGVDVVDMRLIDEHGVGVHMRRIIERVRQAGGHLHVSLDVDFLDPAIAP 238 Query: 255 AVGTTVPGGATFREAHLIMEMLHDSGLVTSLDLAELNPFLDERGRTARLITDLASSLFGR 314 AVGT V GGAT+REAHLIMEMLHD+G+V SLD+ ELNPFLDERG++A L+ DL +SLFGR Sbjct: 239 AVGTAVLGGATYREAHLIMEMLHDAGVVGSLDVVELNPFLDERGKSALLLVDLVASLFGR 298 Query: 315 RVFDRVTT 322 R+ D T Sbjct: 299 RIIDPAVT 306 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 315 Length adjustment: 28 Effective length of query: 296 Effective length of database: 287 Effective search space: 84952 Effective search space used: 84952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate AZOBR_RS19585 AZOBR_RS19585 (arginase)
to HMM TIGR01229 (rocF: arginase (EC 3.5.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01229.hmm # target sequence database: /tmp/gapView.2763.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01229 [M=300] Accession: TIGR01229 Description: rocF_arginase: arginase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-89 286.8 0.0 1.2e-89 286.6 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS19585 AZOBR_RS19585 arginase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS19585 AZOBR_RS19585 arginase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 286.6 0.0 1.2e-89 1.2e-89 2 298 .. 3 299 .. 2 301 .. 0.94 Alignments for each domain: == domain 1 score: 286.6 bits; conditional E-value: 1.2e-89 TIGR01229 2 ivglpfseGqgkrGvdkGpkalreaglleklkdlekevedlgqvaaaklekesd...reavkaersvla 67 i+g+p++ G+g+ G +Gp alr agl+ +l++l++ev+dlg++ +l+ + a + ++a lcl|FitnessBrowser__azobra:AZOBR_RS19585 3 IIGVPIEAGAGHPGALMGPAALRTAGLVRALRELGHEVRDLGDLGRGDLTPAPWsegDAATARLAEITA 71 9*******************************************9777766543334666677777*** PP TIGR01229 68 akeklaekvkkvveekrfplvLggdHsiaiGtvsgvakkakdk..klgvlwlDAHaDintletstSgnl 134 ++++la+ + +++++ +p++LggdHs+ +G+v+gva++ ++ l+vlwlDAH+D+nt++ts+Sgn+ lcl|FitnessBrowser__azobra:AZOBR_RS19585 72 WSRALADRSYAMMQAGGVPVFLGGDHSLSMGSVTGVARHCRETgkPLFVLWLDAHGDFNTPHTSPSGNM 140 ****************************************997768*********************** PP TIGR01229 135 HGmPlafllgrlkkevedleelkllkgkeispkklvyiGlRdvdegErkilkelgikvfsmkeidklGi 203 HGmP+a+l g+ ++++ +e ++ +++p ++ ++G+R++d+gEr++l+ g+ v +m+ id++G+ lcl|FitnessBrowser__azobra:AZOBR_RS19585 141 HGMPVALLCGEDGFDNVFPPE---QRA-TVNPAHVHLFGIRSLDPGERRLLRARGVDVVDMRLIDEHGV 205 **********99999866666...556.6**************************************** PP TIGR01229 204 akvvektleslkaed.pihlSlDvDglDpklapatGtpvrgGltfrEgklilelllesglltaldlvEv 271 + +++ +e++++ +h+SlDvD+lDp +apa+Gt v gG+t+rE++li+e+l+++g + +ld+vE+ lcl|FitnessBrowser__azobra:AZOBR_RS19585 206 GVHMRRIIERVRQAGgHLHVSLDVDFLDPAIAPAVGTAVLGGATYREAHLIMEMLHDAGVVGSLDVVEL 274 ************9999***************************************************** PP TIGR01229 272 NPtldikeksetikaavelvesllget 298 NP+ld e+++ + v+lv+sl+g+ lcl|FitnessBrowser__azobra:AZOBR_RS19585 275 NPFLD--ERGKSALLLVDLVASLFGRR 299 *****..9****************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (300 nodes) Target sequences: 1 (315 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.97 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory