Align agmatinase (EC 3.5.3.11) (characterized)
to candidate AZOBR_RS30775 AZOBR_RS30775 agmatinase
Query= BRENDA::W5PHZ9 (361 letters) >FitnessBrowser__azobra:AZOBR_RS30775 Length = 351 Score = 244 bits (624), Expect = 2e-69 Identities = 137/318 (43%), Positives = 197/318 (61%), Gaps = 19/318 (5%) Query: 44 QASDGPRNQPPSSEFVARSVGICSMMRLPMQ------ATPEGLDAALVGVPLDIGTSNRP 97 Q S G R QP G+ +++ P + A GLD AL+GVP+D+G +NR Sbjct: 34 QFSGGKRVQP--------FAGVSTLLDAPYRPDAADAADFGGLDIALIGVPMDLGVTNRA 85 Query: 98 GARFGPRRIREESVMLRTANPSTGAVPFQFLKVADLGDVNVNLYNLQDSCRL-IRADYQK 156 GAR GPR +R + + VP K+AD+GDV ++ ++C I A Y + Sbjct: 86 GARLGPRAVRGME-RIGPYEHALRMVPAASCKLADVGDVPLSSRFSLEACHGDILAFYNR 144 Query: 157 IVAAGCVPLTLGGDHTITYPILQAIAEKHGPVGLVHVDAHMDTADKALGEKLYHGTPFRR 216 ++ AG VPL++GGDH+ITY IL+A+ + PVG++H DAH DT G K +HG PFR+ Sbjct: 145 VMDAGVVPLSVGGDHSITYSILKALGRER-PVGMIHFDAHCDTGGPYEGAKFHHGGPFRQ 203 Query: 217 CVDEGLLDCKRVVQIGIRGSSTTLDTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMG 276 V +G+LD +R VQIGIRGS+ L + +S G V+ AED + + ++ R+ +G Sbjct: 204 AVLDGVLDPERTVQIGIRGSTEYL--WEFSYDSGMTVIHAEDIPERGIASVIETARKVVG 261 Query: 277 GRPIYISFDIDGLDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDP 336 P+Y+SFD+D LDP +APGTGTPE+ GLT +AL I+RG GL+++G D+VEV+P YD Sbjct: 262 DGPVYVSFDVDCLDPVFAPGTGTPEVGGLTTREALAILRGLDGLDIIGGDVVEVAPQYDA 321 Query: 337 SGNTALVAANLLFEMLCV 354 + NTA A +LFE+LC+ Sbjct: 322 TTNTAHAGAQMLFEILCL 339 Lambda K H 0.321 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 444 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 351 Length adjustment: 29 Effective length of query: 332 Effective length of database: 322 Effective search space: 106904 Effective search space used: 106904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate AZOBR_RS30775 AZOBR_RS30775 (agmatinase)
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.4695.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-58 184.6 0.0 1.8e-58 184.3 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS30775 AZOBR_RS30775 agmatinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS30775 AZOBR_RS30775 agmatinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 184.3 0.0 1.8e-58 1.8e-58 14 273 .. 69 337 .. 56 339 .. 0.89 Alignments for each domain: == domain 1 score: 184.3 bits; conditional E-value: 1.8e-58 TIGR01230 14 evvivgiPydattsyrpGsrhgpeaireastnLeayseeld.rdlallkvvDagdlplaaG.daremve 80 ++ ++g+P+d + r+G+r gp a+r + y++ l + a k++D+gd+pl + ++ + lcl|FitnessBrowser__azobra:AZOBR_RS30775 69 DIALIGVPMDLGVTNRAGARLGPRAVRGME-RIGPYEHALRmVPAASCKLADVGDVPLSSRfSLEACHG 136 67799**********************875.6778888887467777**********965325688899 PP TIGR01230 81 kieevveelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlrdefegeklshacvmrrv 149 i + ++++++g ++++GG+Hsit+++++A ++ +++ +++fDAH+D+ +eg k+ h + r++ lcl|FitnessBrowser__azobra:AZOBR_RS30775 137 DILAFYNRVMDAGVVPLSVGGDHSITYSILKALGRE-RPVGMIHFDAHCDTGGPYEGAKFHHGGPFRQA 204 9*******************************9986.799**********************9988874 PP TIGR01230 150 lelg....lnvlqigiRsgikeeadlarennikvlk.relede.....iaevlakvldkpvyvtiDiDv 208 + g +++qigiR ++ +++ + ++ v++ ++ ++ i+++ + v d pvyv++D+D+ lcl|FitnessBrowser__azobra:AZOBR_RS30775 205 VLDGvldpERTVQIGIRGSTEYLWEFSYDSGMTVIHaEDIPERgiasvIETARKVVGDGPVYVSFDVDC 273 3322244459************************99777777676665888888899************ PP TIGR01230 209 lDPafaPGvgtpepgGltskellklfvlaekekkvvGlDvvEvaPvydssevtaltaaklalell 273 lDP faPG+gtpe+gGlt++e+l+ +++ ++G DvvEvaP yd + ta + a++ e+l lcl|FitnessBrowser__azobra:AZOBR_RS30775 274 LDPVFAPGTGTPEVGGLTTREALA-ILRGLDGLDIIGGDVVEVAPQYDATTNTAHAGAQMLFEIL 337 ************************.889999******************************9998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (351 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.42 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory