Align ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)
to candidate AZOBR_RS23525 AZOBR_RS23525 ABC transporter ATP-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4773 (244 letters) >FitnessBrowser__azobra:AZOBR_RS23525 Length = 269 Score = 231 bits (590), Expect = 9e-66 Identities = 130/247 (52%), Positives = 162/247 (65%), Gaps = 7/247 (2%) Query: 1 MISIKSINKWYGDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDIVV 60 +I I+++ K +G +VL D S V VV GPSGSGKSTL++C N LE +G+I + Sbjct: 1 VIEIRNVYKSFGSTEVLKDVSLTVPPSRTTVVIGPSGSGKSTLLRCCNCLETADRGEIRI 60 Query: 61 DG-TSIAD----PKTNLPKLRSRVGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEATK 115 + T IAD P L LR+ GMVFQ F LFPH+T EN+ A + V G +K EA + Sbjct: 61 NHRTIIADGKPLPDKELNALRAETGMVFQSFNLFPHMTTVENVMRAPVVVRGMAKAEARE 120 Query: 116 KGLQLLERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEV 175 ++LL +VGL A +P LSGGQ+QR AIARALAM P VMLFDEPTSALDPE+V EV Sbjct: 121 LAMELLRKVGLGDKADVYPSTLSGGQKQRAAIARALAMKPKVMLFDEPTSALDPELVGEV 180 Query: 176 LDVMVQLAHEGMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFFGDINARAERTQ 235 L VM LA EGMTMM VTHEMGFAR+VAD V+ M G+I+E E+ F N ERT+ Sbjct: 181 LQVMKTLAEEGMTMMVVTHEMGFAREVADTVVVMADGRIVESGSPEQIF--TNPTQERTR 238 Query: 236 HFLNKIL 242 FL ++ Sbjct: 239 GFLRALV 245 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 269 Length adjustment: 24 Effective length of query: 220 Effective length of database: 245 Effective search space: 53900 Effective search space used: 53900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory