Align ATPase (characterized, see rationale)
to candidate AZOBR_RS00690 AZOBR_RS00690 ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__azobra:AZOBR_RS00690 Length = 268 Score = 244 bits (622), Expect = 2e-69 Identities = 134/257 (52%), Positives = 174/257 (67%), Gaps = 13/257 (5%) Query: 16 SAPETMIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQ 75 +APE ++ E V K +G + L GVSLT + G+V+ ++G SGSGKST LR +N LE Sbjct: 10 NAPEAVL-VENVHKRFG-PLEVLKGVSLTAREGDVITLIGSSGSGKSTLLRCINMLEVPD 67 Query: 76 RGEIWIEGHRLS-----------HDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPV 124 G I I G + D R + IR +GMVFQ FNL+ H+T+L+N++ APV Sbjct: 68 EGRIVIGGEAIGLKKARGGQTVPADSRQVDRIRTRLGMVFQSFNLWTHMTILENVIEAPV 127 Query: 125 QVRRWPVAQAEATARQLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEP 184 V P A+A AR+LL++V I +A+ YP QLSGGQQQR AIARALAMQP+++LFDEP Sbjct: 128 HVLGVPKAEAVDRARKLLDKVGILAKAESYPVQLSGGQQQRAAIARALAMQPKVMLFDEP 187 Query: 185 TSALDPEMVREVLDVMRDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRF 244 TSALDPE+V EVL V+R LA EG TM++ THE+GFAREVA VV + G+I E PPDR Sbjct: 188 TSALDPELVGEVLLVIRQLAEEGNTMILVTHEMGFAREVASEVVFLHQGRIEERGPPDRV 247 Query: 245 FTAPQSDRAKQFLAQIL 261 P+SDR +QFL++ L Sbjct: 248 LVNPESDRVRQFLSRHL 264 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 268 Length adjustment: 25 Effective length of query: 236 Effective length of database: 243 Effective search space: 57348 Effective search space used: 57348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory