Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate AZOBR_RS00690 AZOBR_RS00690 ATP-binding protein
Query= TCDB::Q52666 (263 letters) >FitnessBrowser__azobra:AZOBR_RS00690 Length = 268 Score = 242 bits (618), Expect = 5e-69 Identities = 125/251 (49%), Positives = 173/251 (68%), Gaps = 11/251 (4%) Query: 22 AIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIV 81 A+ + ++K +G VL+ ++LT G+ I + G SGSGKST++RCIN LE G+I++ Sbjct: 14 AVLVENVHKRFGPLEVLKGVSLTAREGDVITLIGSSGSGKSTLLRCINMLEVPDEGRIVI 73 Query: 82 DGIEL-----------TSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVP 130 G + +D + +D++R+ +GMVFQ FNL+ H+TILEN+ AP+ V VP Sbjct: 74 GGEAIGLKKARGGQTVPADSRQVDRIRTRLGMVFQSFNLWTHMTILENVIEAPVHVLGVP 133 Query: 131 KREAEETAMYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDP 190 K EA + A L+KV I +A+ YP QLSGGQQQR AIAR+L M+PK+MLFDEPTSALDP Sbjct: 134 KAEAVDRARKLLDKVGILAKAESYPVQLSGGQQQRAAIARALAMQPKVMLFDEPTSALDP 193 Query: 191 EMIKEVLDTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQS 250 E++ EVL + QLAEEG TM+ VTHEMGFA+ VA+ V+F+ G+I E+ P NP+S Sbjct: 194 ELVGEVLLVIRQLAEEGNTMILVTHEMGFAREVASEVVFLHQGRIEERGPPDRVLVNPES 253 Query: 251 ERTKQFLSQIL 261 +R +QFLS+ L Sbjct: 254 DRVRQFLSRHL 264 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 268 Length adjustment: 25 Effective length of query: 238 Effective length of database: 243 Effective search space: 57834 Effective search space used: 57834 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory