Align PEP1B, component of Uptake system for glutamate and aspartate (characterized)
to candidate AZOBR_RS29610 AZOBR_RS29610 hypothetical protein
Query= TCDB::A1VZQ3 (250 letters) >FitnessBrowser__azobra:AZOBR_RS29610 Length = 221 Score = 137 bits (346), Expect = 1e-37 Identities = 73/214 (34%), Positives = 123/214 (57%), Gaps = 1/214 (0%) Query: 32 WKFLDALDNKDAFINGFIYTLEVSILALLIATIFGTIGGVMATSRFKIIRAYTRIYVELF 91 W+F L+ F G I TL++++L+ I G + GV S +R+ T +YVE+ Sbjct: 5 WQFAIILEYWPIFARGAITTLQITLLSSAIGLFIGLLVGVSRESSGVFLRSVTSVYVEMI 64 Query: 92 QNVPLVIQIFFLFYALPVL-GIRLDIFTIGVLGVGAYHGAYVSEVVRSGILAVPRGQFEA 150 + P ++QI +L+Y P++ G +L T ++ +G + GAYVSE+VR+GI AV GQF A Sbjct: 65 RATPALVQIVWLYYCFPIIFGYQLSAMTSIIIALGIHSGAYVSEIVRAGINAVDTGQFLA 124 Query: 151 SASQGFTYIQQMRYIIVPQTIRIILPPMTNQMVNLIKNTSVLLIVGGAELMHSADSYAAD 210 + S G + +R II+PQ + ++PP+ N+ NL+K T++ ++ EL+ +++ A Sbjct: 125 AKSIGMNHFTALRRIILPQAGQKMIPPLINEFANLMKLTTLGSMIAVYELLQESNNLIAT 184 Query: 211 YGNYAPAYIFAAVLYFIICYPLAYFAKAYENKLK 244 Y F A+ +FII YP + ++ E +LK Sbjct: 185 TYRPLEVYTFLAIFFFIITYPWIWLSQRLERRLK 218 Lambda K H 0.328 0.143 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 134 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 221 Length adjustment: 23 Effective length of query: 227 Effective length of database: 198 Effective search space: 44946 Effective search space used: 44946 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory