Align TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate AZOBR_RS21780 AZOBR_RS21780 peptide ABC transporter ATP-binding protein
Query= TCDB::Q9WXN4 (268 letters) >FitnessBrowser__azobra:AZOBR_RS21780 Length = 326 Score = 171 bits (432), Expect = 2e-47 Identities = 88/239 (36%), Positives = 147/239 (61%), Gaps = 5/239 (2%) Query: 23 IEAVKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLLPPTSGEIYFEGKDIWKDIKDRE 82 ++A+ VSF+++ + +++VGESG GK+T A+ + + PP+SG++ ++G+D+ + Sbjct: 31 VKALDGVSFQLEAGKTLAVVGESGCGKSTLARSVTMIEPPSSGQLLYDGRDVVG--RTAS 88 Query: 83 SLVEFRRKVHAVFQDPFASYNPFYPVERTLWQAISLLENKPSNKKEALELIKESLFRVGI 142 + E RR V VFQ+P+ S NP V L + + + N P K+E E + +VG+ Sbjct: 89 EMKELRRTVQMVFQNPYGSLNPRKTVGSILSEPLVI--NTPMGKQERRERAVAMMAKVGL 146 Query: 143 DPKDVLGKYPHQISGGQKQRIMIARCWILRPLLIVADEPTSMIDASSRGGIIKLLEELRE 202 P D + +YPH SGGQ+QRI IAR +L P ++VADEP S +D S + ++ L+ +L+E Sbjct: 147 RP-DQVDRYPHMFSGGQRQRIAIARALMLNPRVVVADEPVSALDVSIQAQVLNLMMDLQE 205 Query: 203 EQGTSIIFITHDLGLAYYVSDNIFVMKNGEIVERGHPDKVVLEPTHEYTKLLVGSIPKL 261 E + +FI+HDL + +++D + VM G VE G D V P H YT++L+ + P++ Sbjct: 206 ELNLAYLFISHDLSVVRHIADAVMVMYLGRPVEHGPKDVVYSRPRHPYTRILMAATPRV 264 Lambda K H 0.319 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 326 Length adjustment: 26 Effective length of query: 242 Effective length of database: 300 Effective search space: 72600 Effective search space used: 72600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory