Align TM0029, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate AZOBR_RS26240 AZOBR_RS26240 peptide ABC transporter permease
Query= TCDB::Q9WXN6 (280 letters) >FitnessBrowser__azobra:AZOBR_RS26240 Length = 304 Score = 116 bits (290), Expect = 7e-31 Identities = 82/270 (30%), Positives = 134/270 (49%), Gaps = 20/270 (7%) Query: 18 GFSIFLFFLFLGIFGPMF-----YRVDPTEM----TWDYEQPPSSAHPLGTDTYGRDVLA 68 G ++ L L + P YR D E W+ E S HPLGTD GRD L+ Sbjct: 39 GLAVLGLILLLAVLAPFVAPDDPYRQDLMERLVPPVWNAEG--SWTHPLGTDHLGRDYLS 96 Query: 69 QLLHGIRSSLYIGFLAAIISLVIGTIIGSFSAVKRGIVDDVLMGITNIVLTTPSILIAIL 128 +LL+G R SL IGF AA+ S VIGT +G + RG VD V+ + + L+TP +L+A+ Sbjct: 97 RLLYGARVSLLIGFAAALGSGVIGTTLGVCAGYFRGRVDMVVTFLVTVRLSTPVVLVALA 156 Query: 129 IASYLKVRSVEMVAVILGLFQWPWFARAIRAQLMSVMSREYVYLSVMAGYSDLRLVIEDL 188 + + L S+E+V ++L W FA +R + S++YV + G S R++ ++ Sbjct: 157 VVA-LFGGSLEVVILVLSALLWDRFAIVMRTSTIQATSQDYVLAAQAVGCSVPRIIFGEI 215 Query: 189 IPTIATYAFMSFVLFINGGIMGEAGLSLIGLGPTQGISLGIMLQWAVLMEAVRRGLW--- 245 +P + + L + I+ EA LS +GLG + W +++ R L+ Sbjct: 216 LPNVLNNLIIVATLEMAHAILLEAALSFLGLGVQPPLP-----SWGLMVAEGRSNLFFEP 270 Query: 246 WWFVPPGLAIVAVTASLLVISTAMDEVFNP 275 W PG+A+ + ++ ++ + +V P Sbjct: 271 WLIAIPGVALFLLVLAINLVGDGVRDVTAP 300 Lambda K H 0.330 0.144 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 304 Length adjustment: 26 Effective length of query: 254 Effective length of database: 278 Effective search space: 70612 Effective search space used: 70612 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory