Align CbtF, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate AZOBR_RS21780 AZOBR_RS21780 peptide ABC transporter ATP-binding protein
Query= TCDB::Q97VF4 (324 letters) >FitnessBrowser__azobra:AZOBR_RS21780 Length = 326 Score = 196 bits (498), Expect = 6e-55 Identities = 106/284 (37%), Positives = 166/284 (58%), Gaps = 12/284 (4%) Query: 27 ALKDVSLSMNQGDLLIVLGESGAGKTTLGRVIVGLQKPTSGEVVYDGYNIWKNKRKIFKK 86 AL VS + G L V+GESG GK+TL R + ++ P+SG+++YDG ++ K+ Sbjct: 33 ALDGVSFQLEAGKTLAVVGESGCGKSTLARSVTMIEPPSSGQLLYDGRDVVGRTASEMKE 92 Query: 87 YRKDVQLIPQDPYSTLPFNKTVEEILVAPILRWEKINKDELRKRLINLLELVKLTPAEEF 146 R+ VQ++ Q+PY +L KTV IL P++ + K E R+R + ++ V L P + Sbjct: 93 LRRTVQMVFQNPYGSLNPRKTVGSILSEPLVINTPMGKQERRERAVAMMAKVGLRPDQ-- 150 Query: 147 LGKYPHQLSGGQKQRLSIARSLSVNPRIIVADEPVTMVDASLRIGILNTLAEIKNRLNLT 206 + +YPH SGGQ+QR++IAR+L +NPR++VADEPV+ +D S++ +LN + +++ LNL Sbjct: 151 VDRYPHMFSGGQRQRIAIARALMLNPRVVVADEPVSALDVSIQAQVLNLMMDLQEELNLA 210 Query: 207 MVFITHDIPIARYFYHLFDKGNTIVMFAGRIVERADLEEILKDPLHPYTNDLIKLTPSID 266 +FI+HD+ + R H+ D +VM+ GR VE + + P HPYT L+ TP ++ Sbjct: 211 YLFISHDLSVVR---HIADA--VMVMYLGRPVEHGPKDVVYSRPRHPYTRILMAATPRVN 265 Query: 267 NLYKEINVKINYE-----RVEKGCPYRLRCPFAMDICKNEEPKL 305 + V E GCP+ RCP+A + C E P L Sbjct: 266 PALRAERVIPKGELPSPLNPPPGCPFHKRCPYATERCATEVPAL 309 Lambda K H 0.321 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 326 Length adjustment: 28 Effective length of query: 296 Effective length of database: 298 Effective search space: 88208 Effective search space used: 88208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory