Align CbtF, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate AZOBR_RS26740 AZOBR_RS26740 peptide ABC transporter ATP-binding protein
Query= TCDB::Q97VF4 (324 letters) >FitnessBrowser__azobra:AZOBR_RS26740 Length = 315 Score = 177 bits (449), Expect = 3e-49 Identities = 112/323 (34%), Positives = 179/323 (55%), Gaps = 19/323 (5%) Query: 3 LMELKGVSVIFEDKVGLFKKRKFYALKDVSLSMNQGDLLIVLGESGAGKTTLGRVIVGLQ 62 L EL+GVS +F + ++ A+ V L++ +G+L+ ++GESG GK+T+ R+ GL Sbjct: 5 LAELRGVSRLFP--IPGWRGAVLRAVDGVDLAVRRGELVGLVGESGCGKSTVARIATGLL 62 Query: 63 KPTSGEVVYDGYNIWKNKRKIFKKYRKDVQLIPQDPYSTLPFNKTVEEILVAPILRWEKI 122 P++G V+ DG + + + R VQ++ Q+P+++L TVEEI+ + + Sbjct: 63 PPSAGRVLIDGQDAAERPAAEARAARLRVQMVFQNPHASLNPRFTVEEIVGEAVRHHRLV 122 Query: 123 NKDELRKRLINLLELVKLTPAEEFLGKYPHQLSGGQKQRLSIARSLSVNPRIIVADEPVT 182 + L + + L V L PA +PH+ SGGQ+QR+ IAR+L+V P ++V DEPVT Sbjct: 123 PRAALAEHVAAQLLRVGLDPALRH--HHPHRFSGGQRQRIGIARALAVRPDLLVCDEPVT 180 Query: 183 MVDASLRIGILNTLAEIKNRLNLTMVFITHDIPIARYFYHLFDKGNTIVMFAGRIVERAD 242 +D S+R GILN ++++R L ++FI+HD+ + H+ D+ +VM+ GR+VE Sbjct: 181 ALDVSVRAGILNLFLDLRDRDGLAILFISHDLSVVG---HICDR--VVVMYLGRVVEEGP 235 Query: 243 LEEILKDPLHPYTNDLIKLTPSIDNLYKEINVKINYERVE-----KGCPYRLRCPFAMDI 297 ++ + + P HPYT L+ + S E V + E GCP+ RCP A Sbjct: 236 VDALFERPRHPYTQALLADSRS---ALPEGTVPVRGEAPSLAERPAGCPFHPRCPMARPD 292 Query: 298 CKNEEPKL--FKYSHEVACFLYG 318 C+ E P L H VAC L G Sbjct: 293 CRREVPVLRGVGEGHRVACLLAG 315 Lambda K H 0.321 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 315 Length adjustment: 28 Effective length of query: 296 Effective length of database: 287 Effective search space: 84952 Effective search space used: 84952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory