Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate AZOBR_RS15495 AZOBR_RS15495 ABC transporter ATPase
Query= BRENDA::Q97UY8 (353 letters) >FitnessBrowser__azobra:AZOBR_RS15495 Length = 360 Score = 206 bits (525), Expect = 6e-58 Identities = 118/270 (43%), Positives = 164/270 (60%), Gaps = 4/270 (1%) Query: 16 GKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKL 75 G+VVA+D+V++ I GE + GPSG GK++ +RI AGL+ TG + +VA + Sbjct: 16 GRVVAVDDVSVTIGAGEIVCLCGPSGCGKSSLLRIAAGLEAVQTGSVRIGGTVVADE-RG 74 Query: 76 IVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLN 135 VPPE R +G+VFQ +AL+P+L+ +N+ F LT +S E RKR E + + + Sbjct: 75 AVPPERRGVGLVFQDYALFPHLSVLDNVRFGLT--ALSGEAQRKRALETLGQVGMAGYAD 132 Query: 136 HFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLL 195 FP LSGGQQQRVALARAL +P++LLLDEPFS LDAR+R+ R V + G + Sbjct: 133 SFPHHLSGGQQQRVALARALAPNPAVLLLDEPFSGLDARLREQVRDETLHVLKQNGAATM 192 Query: 196 VVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEG 255 +V+HDP + +ADR+ ++ GK+VQVG P DLY PV+ A GE+N L G V Sbjct: 193 LVTHDPEEAMFLADRIALMRAGKVVQVGNPVDLYTRPVNAFAAEFFGEVNRLSGVVQGGA 252 Query: 256 VVIGSLRFPVSVSSDRAI-IGIRPEDVKLS 284 V P V+ A+ + IRPE +KLS Sbjct: 253 VDTPVGPIPTEVADGTAVDVLIRPEALKLS 282 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 360 Length adjustment: 29 Effective length of query: 324 Effective length of database: 331 Effective search space: 107244 Effective search space used: 107244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory