Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate AZOBR_RS18180 AZOBR_RS18180 sugar ABC transporter
Query= uniprot:A3DE71 (289 letters) >FitnessBrowser__azobra:AZOBR_RS18180 Length = 273 Score = 159 bits (403), Expect = 5e-44 Identities = 87/270 (32%), Positives = 147/270 (54%), Gaps = 11/270 (4%) Query: 25 LAILVVLTLG--PIVFMVLTSLMDHNAIARGKW-IAPT--RFSNYVEVFQKLPFGIYFRN 79 LA+LV+L + P+ +M++TSL + + + PT + Y F + + N Sbjct: 10 LAVLVLLGVAAFPLYWMLVTSLTPSERLFDDRPNLLPTLSQIGTYAAAFTETSLRQWLIN 69 Query: 80 SLIVCSIVMVVALVIATLAGYSLAKYKFPGSGFFGILILATQLLPGMMFLLPLYLDFVKI 139 SLIV V++++++ L Y+L++ F G G + TQ+LP M ++PLY F K+ Sbjct: 70 SLIVAVGTTVLSILLSVLPAYALSRLTFNGKLLLGFALFMTQMLPEAMLVVPLYDIFTKL 129 Query: 140 KQATGIQLINSIPGLVIVYSAFFVPFSIWIIRGFFASIPGELEEAARIDGCNKFTAFLRV 199 L+N++ GL++ +AF VP WI++G +P E+EEAAR+DGC++ L V Sbjct: 130 S------LLNTLLGLILANTAFTVPVVTWILKGAIDGVPSEIEEAARVDGCSRLGIVLAV 183 Query: 200 MLPLAVPGIVATAIYIFLTAWDELIFAWVLLKDTKVTTIPAGIRGFIAYTTARYDLLMAA 259 ++PL P + A A+ F W+E +FA + D + T G+ F+ + +MA Sbjct: 184 VVPLIAPTLAAAAVIAFFHGWNEYVFAQTFISDDALRTASVGLASFVGELSTPVHTVMAV 243 Query: 260 GTIVTIPVLIMFFTMQKKFISGMTAGAVKG 289 G I T+P ++ + +Q+ ++GMT G VKG Sbjct: 244 GFIYTLPAVVFYLFVQRYVVAGMTTGGVKG 273 Lambda K H 0.332 0.145 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 273 Length adjustment: 26 Effective length of query: 263 Effective length of database: 247 Effective search space: 64961 Effective search space used: 64961 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory