Align citrate (pro-3S)-lyase (EC 4.1.3.6) (characterized)
to candidate AZOBR_RS26360 AZOBR_RS26360 Citrate lyase
Query= BRENDA::Q037K5 (292 letters) >FitnessBrowser__azobra:AZOBR_RS26360 Length = 305 Score = 124 bits (310), Expect = 3e-33 Identities = 97/299 (32%), Positives = 141/299 (47%), Gaps = 32/299 (10%) Query: 6 RTMMFVPGANPGMLRDAPIYGADAIMFDLEDAVSLKEKDTARMLVYSALKTFDYSSV--- 62 R+++FVP + P A GADA+ DLEDAV+ K AR + Sbjct: 7 RSVLFVPASRPDRFDKALAAGADAVCVDLEDAVAPAHKQDARAAAMRFVADGSNGGSGGG 66 Query: 63 ----------ETVVRVNAL-DAGGDQD----IEAMVLGGINVVRLPKTETAQDIIDVDAV 107 + V+R+N L G +D IEA GG VV PK ++ +++ +D + Sbjct: 67 GGGGGGGGGPDRVIRINTLRSVAGMRDALALIEARPSGGTVVV--PKIDSPEEVCWLDQL 124 Query: 108 ITAVEEKYGIQNGTTHMMAAIESAEGVLNAREIAQASSRMIGIALGAEDYLTSQHTHRST 167 +T G+ ++A IE+ GV A I AS R+ + G D S Sbjct: 125 LTEA----GLD---LRLVAQIETLRGVDQAAAITAASRRVSAVMFGGLDLAAELGVPASW 177 Query: 168 DGAELSFARNYILHAAREAGIAAIDTVYTQVDNEEGLRHETALIKQLGFDGKSVINPRQI 227 DG L + R+ ++HAA AGI AID + V + +G R E LGF K I+P Q+ Sbjct: 178 DG--LLYGRSRVVHAAARAGIPAIDMPFVAVRDADGCRAEAQRALALGFTAKMAIHPGQV 235 Query: 228 PVINGVFAPALAEVQKAREIVAGLKEAEAKGAGVVSVNGQMVDKPVVERAQYTIALAKA 286 P IN + P EV A IV K A GV+ V+G+MV++P+V + T+A A+A Sbjct: 236 PTINDAYTPTPDEVADAERIVTAWKNAP---DGVIQVDGKMVERPIVLAMRRTLARAQA 291 Lambda K H 0.316 0.132 0.355 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 305 Length adjustment: 27 Effective length of query: 265 Effective length of database: 278 Effective search space: 73670 Effective search space used: 73670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory