Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate AZOBR_RS29825 AZOBR_RS29825 iron ABC transporter permease
Query= SwissProt::P15030 (332 letters) >FitnessBrowser__azobra:AZOBR_RS29825 Length = 343 Score = 163 bits (412), Expect = 7e-45 Identities = 111/322 (34%), Positives = 170/322 (52%), Gaps = 12/322 (3%) Query: 15 VAALIIIFWLSLFCYSAIPVSGADATRALLP----GHTPTLP--EALVQNLRLPRSLVAV 68 VAAL++ F A PV+ + L G P E ++ ++R PR L A+ Sbjct: 18 VAALLVAAVCVAFSTGAYPVTPGELAGLLAAKLGLGSAAVTPAVETVIWDIRGPRVLTAM 77 Query: 69 LIGASLALAGTLLQTLTHNPMASPSLLGINSGAALAMALTSALSPTPIAGYSLSFIAACG 128 L+GA LA +G Q L NP+ SP +LG++SGAAL L S +A ++F G Sbjct: 78 LVGAGLAASGAAYQGLFRNPLVSPDILGVSSGAALGAVLGIFASLPVLAIQGMAF---AG 134 Query: 129 GGVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITLLLAEDHAY--GIFYWLA 186 G ++ +V+ R L+L G+ + A + LA+ + I +WL Sbjct: 135 GLLAVGVVLAVASAIRGRDPVLVLVLGGVVIGALLGSGVALLKYLADPYNQLPAITFWLL 194 Query: 187 GGVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTLGVNLTRLRLVINMLV 246 G +S D+ L+P V A+ ++LL +L+++ L D A LGV + +R+V+ + Sbjct: 195 GSLSAVNRGDLAALVPPVAVALLPLVLLRWRLDVMTLGDEEATALGVPVRVVRIVVIVAA 254 Query: 247 LLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGATLMLLADVLARALAF 306 L+ A VSV+G V ++GLLVPHLAR G +LP ++LLGA +L D LAR+L Sbjct: 255 TLMTAAAVSVSGIVGWVGLLVPHLARLMVGPAFVRLLPTAVLLGAAYLLAVDTLARSLG- 313 Query: 307 PGDLPAGAVLALIGSPCFVWLV 328 P +LP G + A+IG+P F+WL+ Sbjct: 314 PVELPLGVLTAVIGTPVFLWLL 335 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 343 Length adjustment: 28 Effective length of query: 304 Effective length of database: 315 Effective search space: 95760 Effective search space used: 95760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory