Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate AZOBR_RS29825 AZOBR_RS29825 iron ABC transporter permease
Query= CharProtDB::CH_004160 (318 letters) >FitnessBrowser__azobra:AZOBR_RS29825 Length = 343 Score = 169 bits (427), Expect = 1e-46 Identities = 115/276 (41%), Positives = 160/276 (57%), Gaps = 11/276 (3%) Query: 46 VLMEYRLPRLLLALFVGAALAVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLLMPS 105 V+ + R PR+L A+ VGA LA +G QG+ RNPL SPDILGV+ A+L +V L + S Sbjct: 64 VIWDIRGPRVLTAMLVGAGLAASGAAYQGLFRNPLVSPDILGVSSGAALGAV--LGIFAS 121 Query: 106 LPVMVLPLLAFAGGM--AGLILLKMLA-KTHQP-MKLALTGVALSACWASLTDYLM-LSR 160 LPV+ + +AFAGG+ G++L A + P + L L GV + A S L L+ Sbjct: 122 LPVLAIQGMAFAGGLLAVGVVLAVASAIRGRDPVLVLVLGGVVIGALLGSGVALLKYLAD 181 Query: 161 PQDVNNAL-LWLTGSLWGRD-WSFVKIAIPLMILFLPLSLSFCRDLDLLALGDARATTLG 218 P + A+ WL GSL + + P+ + LPL L R LD++ LGD AT LG Sbjct: 182 PYNQLPAITFWLLGSLSAVNRGDLAALVPPVAVALLPLVLLRWR-LDVMTLGDEEATALG 240 Query: 219 VSVPHTRFWALLLAVAMTSTGVAACGPISFIGLVVPHMMRSITGGRHRRLLPVSALTGAL 278 V V R ++ A MT+ V+ G + ++GL+VPH+ R + G RLLP + L GA Sbjct: 241 VPVRVVRIVVIVAATLMTAAAVSVSGIVGWVGLLVPHLARLMVGPAFVRLLPTAVLLGAA 300 Query: 279 LLVVADLLARIIHPPLELPVGVLTAIIGAPWFVWLL 314 L+ D LAR + P+ELP+GVLTA+IG P F+WLL Sbjct: 301 YLLAVDTLARSL-GPVELPLGVLTAVIGTPVFLWLL 335 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 343 Length adjustment: 28 Effective length of query: 290 Effective length of database: 315 Effective search space: 91350 Effective search space used: 91350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory