Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate AZOBR_RS00690 AZOBR_RS00690 ATP-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >FitnessBrowser__azobra:AZOBR_RS00690 Length = 268 Score = 311 bits (796), Expect = 1e-89 Identities = 152/248 (61%), Positives = 200/248 (80%) Query: 6 VQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLNNE 65 V+++HKR+G EVLKGVSL A GDVI++IGSSGSGKST LRCIN+LE P G+I++ E Sbjct: 17 VENVHKRFGPLEVLKGVSLTAREGDVITLIGSSGSGKSTLLRCINMLEVPDEGRIVIGGE 76 Query: 66 ELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSKTE 125 + L + G AD +Q+ R+R+RL MVFQ FNLW+HMT +EN++EAPVHVLG+ K E Sbjct: 77 AIGLKKARGGQTVPADSRQVDRIRTRLGMVFQSFNLWTHMTILENVIEAPVHVLGVPKAE 136 Query: 126 AREKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPELV 185 A ++A L+KVG+ + ++YP +SGG+QQR AIARALAM+P+VMLFDEPTSALDPELV Sbjct: 137 AVDRARKLLDKVGILAKAESYPVQLSGGQQQRAAIARALAMQPKVMLFDEPTSALDPELV 196 Query: 186 GDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSERL 245 G+VL V++ LA+EG TM++VTHEMGFAREV++++VFLH+G +EE G P VLVNP+S+R+ Sbjct: 197 GEVLLVIRQLAEEGNTMILVTHEMGFAREVASEVVFLHQGRIEERGPPDRVLVNPESDRV 256 Query: 246 QQFLSGSL 253 +QFLS L Sbjct: 257 RQFLSRHL 264 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 268 Length adjustment: 25 Effective length of query: 229 Effective length of database: 243 Effective search space: 55647 Effective search space used: 55647 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory