Align ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized)
to candidate AZOBR_RS00685 AZOBR_RS00685 amino acid ABC transporter substrate-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3431 (257 letters) >FitnessBrowser__azobra:AZOBR_RS00685 Length = 278 Score = 145 bits (366), Expect = 9e-40 Identities = 93/279 (33%), Positives = 144/279 (51%), Gaps = 29/279 (10%) Query: 1 MKKLVLLGALALSVLSLPTFA---DEKPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNAL 57 +KK+V AL V T A D K ++I E AY P+ + P G ++GF+ D+ L Sbjct: 1 VKKIVAALALGAIVAVAGTAAEAKDWKKIRIATEGAYAPWNATDPSGKLIGFEPDLALEL 60 Query: 58 CEEMKVKCVWVEQEFDGLIPALKVRKIDAILSSMSITEDRKKSVDFTNKYYNTPARL-VM 116 C+ +K +C V Q++DG+IPA++ K DAI+++MSIT++R+K + F Y P+ M Sbjct: 61 CKRIKAECEIVAQDWDGMIPAIQQGKYDAIMAAMSITDEREKVIAFAGPYGTEPSMFGTM 120 Query: 117 KAG--------------------TAVSENLAELKGKNIGVQRGSIHERFAREVLAPLGAE 156 K A++ LKGK +GVQ +I F ++L + Sbjct: 121 KNSPLAKATFPGERYDLSKDDPKAAIAALADALKGKTVGVQTSTIQANFMEKLLPQVA-- 178 Query: 157 IKPYGSQNEIYLDVAAGRLDGTVADATLLDDGFLKTDAGKGFAFVGPAFTDVKYFGDGVG 216 ++ Y + +D+AAGR+D D + + D LK DAG G GPAF G GVG Sbjct: 179 VRTYDKLDNAGIDMAAGRVDAIFGDRSAV-DAILKADAGNGMTLFGPAFAR-GVLGKGVG 236 Query: 217 IAVRKGDA-LKDKINTAIAAIRENGKYKQIQDKYFAFDI 254 + +RK D LK+ N AIA ++G ++ ++F +DI Sbjct: 237 VGLRKADGDLKELFNKAIAEANQDGTITKLSTQHFGYDI 275 Lambda K H 0.318 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 12 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 278 Length adjustment: 25 Effective length of query: 232 Effective length of database: 253 Effective search space: 58696 Effective search space used: 58696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory