GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PS417_17605 in Azospirillum brasilense Sp245

Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate AZOBR_RS00690 AZOBR_RS00690 ATP-binding protein

Query= uniprot:A0A1N7U8S3
         (276 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS00690 AZOBR_RS00690 ATP-binding
           protein
          Length = 268

 Score =  305 bits (782), Expect = 5e-88
 Identities = 159/249 (63%), Positives = 195/249 (78%), Gaps = 3/249 (1%)

Query: 29  VEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGVITLDGI 88
           VE +HKR+G  EVLKGVSL AR+GDVI+LIG+SGSGKST+LRCIN LE PD G I + G 
Sbjct: 17  VENVHKRFGPLEVLKGVSLTAREGDVITLIGSSGSGKSTLLRCINMLEVPDEGRIVIGGE 76

Query: 89  SIEMRQGRAGTRAPHQD-QLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRVLDVSAAE 147
           +I +++ R G   P    Q+  +RTRL MVFQ FNLW+HMT+LEN+  AP  VL V  AE
Sbjct: 77  AIGLKKARGGQTVPADSRQVDRIRTRLGMVFQSFNLWTHMTILENVIEAPVHVLGVPKAE 136

Query: 148 AEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSALDPEL 207
           A  RAR  LDKVG+ ++ A+ YP  LSGGQQQR AIARALAM+P+++LFDEPTSALDPEL
Sbjct: 137 AVDRARKLLDKVGILAK-AESYPVQLSGGQQQRAAIARALAMQPKVMLFDEPTSALDPEL 195

Query: 208 VGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGRVEEHGDA-RILDQPNSER 266
           VGEVL VI+ LAEEG TM++VTHEMGFAR+V+S+V+FLHQGR+EE G   R+L  P S+R
Sbjct: 196 VGEVLLVIRQLAEEGNTMILVTHEMGFAREVASEVVFLHQGRIEERGPPDRVLVNPESDR 255

Query: 267 LQQFLSNRL 275
           ++QFLS  L
Sbjct: 256 VRQFLSRHL 264


Lambda     K      H
   0.319    0.133    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 252
Number of extensions: 13
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 276
Length of database: 268
Length adjustment: 25
Effective length of query: 251
Effective length of database: 243
Effective search space:    60993
Effective search space used:    60993
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory