GapMind for catabolism of small carbon sources

 

Aligments for a candidate for arcB in Azospirillum brasilense Sp245

Align Ornithine carbamoyltransferase, catabolic; OTCase; EC 2.1.3.3 (characterized)
to candidate AZOBR_RS13250 AZOBR_RS13250 ornithine carbamoyltransferase

Query= SwissProt::P08308
         (336 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS13250 AZOBR_RS13250 ornithine
           carbamoyltransferase
          Length = 334

 Score =  490 bits (1262), Expect = e-143
 Identities = 235/335 (70%), Positives = 283/335 (84%), Gaps = 1/335 (0%)

Query: 1   MAFNMHNRNLLSLMHHSTRELRYLLDLSRDLKRAKYTGTEQQHLKRKNIALIFEKTSTRT 60
           M+FN+ NR+LL++  ++ RE RY+LDL+RDLKRAKY  TEQQHL+ K I LIFEKTSTRT
Sbjct: 1   MSFNLRNRSLLTVQDYTPREFRYVLDLARDLKRAKYARTEQQHLRGKEICLIFEKTSTRT 60

Query: 61  RCAFEVAAYDQGANVTYIDPNSSQIGHKESMKDTARVLGRMYDAIEYRGFKQEIVEELAK 120
           RCAFEVA +DQGANVTY+DP  SQIGHKES KDTARVLGRMYDAIEYRG  Q  VE+LAK
Sbjct: 61  RCAFEVACHDQGANVTYLDPAGSQIGHKESFKDTARVLGRMYDAIEYRGAAQGGVEQLAK 120

Query: 121 FAGVPVFNGLTDEYHPTQMLADVLTMREHSDKPLHDISYAYLGDARNNMGNSLLLIGAKL 180
           +AGVPV+NGLTDEYHPTQMLADV+TMREHSDKP+ DI+YAY+GD R+NMG+SL+++G  +
Sbjct: 121 YAGVPVYNGLTDEYHPTQMLADVMTMREHSDKPITDITYAYVGDTRSNMGHSLMIVGCLM 180

Query: 181 GMDVRIAAPKALWPHDEFVAQCKKFAEESGAKLTLTEDPKEAVKGVDFVHTDVWVSMGEP 240
           GMDVRI  P++LWP +E+ A  +K A  SGA+LT+T++  EAV GVDF+HTDVWVSMGEP
Sbjct: 181 GMDVRICGPQSLWPSEEYTAIARKLAAASGARLTITDNTAEAVAGVDFIHTDVWVSMGEP 240

Query: 241 VEAWGERIKELLPYQVNMEIMKATGNPRAKFMHCLPAFHNSETKVGKQIAEQYPNLANGI 300
            + W ERI  L PYQVN E+M A+GNP+ KFMHCLPAFH+SET +G+QIAE Y  + NG+
Sbjct: 241 KDVWRERIALLKPYQVNPELMAASGNPQVKFMHCLPAFHDSETTLGRQIAEDY-GMPNGL 299

Query: 301 EVTEDVFESPYNIAFEQAENRMHTIKAILVSTLAD 335
           EVT +VFES  NIAFEQAENRMHTIKA+LV+TL +
Sbjct: 300 EVTNEVFESEANIAFEQAENRMHTIKALLVATLGE 334


Lambda     K      H
   0.318    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 410
Number of extensions: 5
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 336
Length of database: 334
Length adjustment: 28
Effective length of query: 308
Effective length of database: 306
Effective search space:    94248
Effective search space used:    94248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate AZOBR_RS13250 AZOBR_RS13250 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00658.hmm
# target sequence database:        /tmp/gapView.27619.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00658  [M=304]
Accession:   TIGR00658
Description: orni_carb_tr: ornithine carbamoyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   1.1e-129  418.0   0.0   1.2e-129  417.8   0.0    1.0  1  lcl|FitnessBrowser__azobra:AZOBR_RS13250  AZOBR_RS13250 ornithine carbamoy


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__azobra:AZOBR_RS13250  AZOBR_RS13250 ornithine carbamoyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  417.8   0.0  1.2e-129  1.2e-129       1     303 [.       8     332 ..       8     333 .. 0.99

  Alignments for each domain:
  == domain 1  score: 417.8 bits;  conditional E-value: 1.2e-129
                                 TIGR00658   1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvl 69 
                                               r+ll+++d++++e++++l+la++lk++k++ +e+++l+gk++ liFek+stRtR++feva  ++Ga+v+
  lcl|FitnessBrowser__azobra:AZOBR_RS13250   8 RSLLTVQDYTPREFRYVLDLARDLKRAKYARTEQQHLRGKEICLIFEKTSTRTRCAFEVACHDQGANVT 76 
                                               789****************************************************************** PP

                                 TIGR00658  70 ylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDllt 138
                                               yl++  +q+g+kes+kDtarvl+r++dai +R+ ++  ve+lakya+vPv+ngLtd+ hP+q+laD++t
  lcl|FitnessBrowser__azobra:AZOBR_RS13250  77 YLDPAGSQIGHKESFKDTARVLGRMYDAIEYRGAAQGGVEQLAKYAGVPVYNGLTDEYHPTQMLADVMT 145
                                               ********************************************************************* PP

                                 TIGR00658 139 ikeklg.klkevklvyvGDa.nnvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkle 205
                                               ++e+ +  + +++++yvGD+  n+++sl++ + ++G+dv++++P+ l+p++e++  a+k+a+++g++l+
  lcl|FitnessBrowser__azobra:AZOBR_RS13250 146 MREHSDkPITDITYAYVGDTrSNMGHSLMIVGCLMGMDVRICGPQSLWPSEEYTAIARKLAAASGARLT 214
                                               ******99************9************************************************ PP

                                 TIGR00658 206 ltedpkkavkdadviytDvwvsmGe.eekkeerlkllkpyqvneellela.kpevkflhCLPavr.... 268
                                               +t+++++av+++d+i+tDvwvsmGe ++ + er++llkpyqvn el++ + +p+vkf+hCLPa++    
  lcl|FitnessBrowser__azobra:AZOBR_RS13250 215 ITDNTAEAVAGVDFIHTDVWVSMGEpKDVWRERIALLKPYQVNPELMAASgNPQVKFMHCLPAFHdset 283
                                               *************************9999********************99****************** PP

                                 TIGR00658 269 ..............GeevtdevlegeasivfdeaenRlhaqkavlkall 303
                                                             G evt+ev+e+ea+i f++aenR+h++ka+l+a+l
  lcl|FitnessBrowser__azobra:AZOBR_RS13250 284 tlgrqiaedygmpnGLEVTNEVFESEANIAFEQAENRMHTIKALLVATL 332
                                               *********************************************9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (304 nodes)
Target sequences:                          1  (334 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.89
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory