Align 3-hydroxybutyryl-CoA dehydratase; EC 4.2.1.55 (characterized)
to candidate AZOBR_RS09775 AZOBR_RS09775 enoyl-CoA hydratase
Query= CharProtDB::CH_091794 (261 letters) >FitnessBrowser__azobra:AZOBR_RS09775 Length = 263 Score = 159 bits (403), Expect = 4e-44 Identities = 95/253 (37%), Positives = 138/253 (54%), Gaps = 5/253 (1%) Query: 4 NNVILEKEGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEKSFV 63 N V+ G +A +T+NRP LNA+++ M + +E D+ V A+I+TGAGE++F Sbjct: 12 NPVLCVTAGGIATLTLNRPAKLNAISTALAAAMLDTLDALEVDAAVRAIIVTGAGERAFS 71 Query: 64 AGADISEMKEMNTIEGRKFGIL----GNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSC 119 AGADI+E G + + G + R+E KP+IAAVNG GGGCEI + Sbjct: 72 AGADIAEFTPA-VRRGPEAAVRAFRPGQTLCARIESFPKPIIAAVNGICYGGGCEILEAS 130 Query: 120 DIRIASSNARFGQPEVGLGITPGFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLV 179 + +AS A F + E+ LG+ P FGGTQRL R G A + + T AL +GLV Sbjct: 131 HLAVASERASFSKAEIRLGMMPTFGGTQRLPRNAGRKRALEWLLTGDTFPPAMALAVGLV 190 Query: 180 NKVVEPSELMNTAKEIANKIVSNAPVAVKLSKQAINRGMQCDIDTALAFESEAFGECFST 239 N+VV L+ A E+A +IV ++P AV A+ RG+ I LA E+E F Sbjct: 191 NQVVPHDALLPAAFELAGRIVRHSPAAVSGILGAVTRGLNMTIGEGLAVETERFARLAPG 250 Query: 240 EDQKDAMTAFIEK 252 D +D + A++ + Sbjct: 251 ADLRDGLEAWLAR 263 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 263 Length adjustment: 25 Effective length of query: 236 Effective length of database: 238 Effective search space: 56168 Effective search space used: 56168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory