Align proline racemase (EC 5.1.1.4) (characterized)
to candidate AZOBR_RS27830 AZOBR_RS27830 proline racemase
Query= BRENDA::A8DEZ8 (335 letters) >FitnessBrowser__azobra:AZOBR_RS27830 Length = 337 Score = 255 bits (651), Expect = 1e-72 Identities = 134/336 (39%), Positives = 200/336 (59%), Gaps = 2/336 (0%) Query: 1 MKFSRSIQAIDSHTAGEATRIVVGGIPNIKGNSMPEKKEYLEENLDYLRTAIMLEPRGHN 60 M+ + + +HT GE I+ GIP G+S+ EK+++LE + D+LR A+M EPRGH Sbjct: 1 MRMQDAFDVLYTHTEGEPLCIIHSGIPYPAGSSILEKRQFLETHYDWLREALMREPRGHK 60 Query: 61 DMFGSVMTQPCCPDADFGIIFMDGGGYLNMCGHGTIGAMTAAIETGVVPAVEPVTHVV-M 119 DMFG +T P PD D G+I++DG Y +MCGHGTI A + G+V E ++ Sbjct: 61 DMFGVFLTPPSGPDYDAGLIYIDGTQYSHMCGHGTIAVAMAMVANGLVRRGENGRTIIRF 120 Query: 120 EAPAGIIRGDVTVVDGKAKEVSFLNVPAFLYKEGVEVDLPGVGTVKFDISFGGSFFAIIH 179 E AG++ +V + F NVPA++ + VE +LP +G +K DI +GG++F II Sbjct: 121 ETTAGLVVAEVAHEGDRVLWTKFENVPAYVAAQDVEFELPEIGPLKADIVWGGNYFGIID 180 Query: 180 ASQLGLKIEPQNAGKLTELAMKLRDIINEKIEIQHPTLAHIKTVDLVEIYDEPTHPEATY 239 + L+I P+N L+ + R+ + +K+ IQHP AHI + V + EPT A Y Sbjct: 181 LTGTSLRIGPENGTALSHYGILAREQLRQKVAIQHPASAHINNFNFVTFWHEPTIEGAFY 240 Query: 240 KNVVIFGQGQVDRSPCGTGTSAKLATLHAKGELKVGEKFVYESILGT-LFKGEIVEETKV 298 KNV +F GQ+DRSP GTGTSA +A A+G++ +G+ E +LGT F+G ++ ET++ Sbjct: 241 KNVHVFSAGQLDRSPGGTGTSAMMAMFEARGKMAIGDTIRSEGLLGTGTFEGSLLGETRL 300 Query: 299 ADFNAVVPKITGSAYITGFNHFVIDEEDPLKHGFIL 334 AV P + G+A I G +VID DP+ GF++ Sbjct: 301 NGVRAVRPTVKGTASILGTARWVIDRNDPVGAGFLV 336 Lambda K H 0.319 0.139 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 337 Length adjustment: 28 Effective length of query: 307 Effective length of database: 309 Effective search space: 94863 Effective search space used: 94863 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory