GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoD in Azospirillum brasilense Sp245

Align 5'-fluoro-5'-deoxy-adenosine phosphorylase (EC 2.4.2.1) (characterized)
to candidate AZOBR_RS09940 AZOBR_RS09940 5'-methylthioadenosine phosphorylase

Query= metacyc::MONOMER-15923
         (299 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS09940 AZOBR_RS09940
           5'-methylthioadenosine phosphorylase
          Length = 294

 Score =  271 bits (693), Expect = 1e-77
 Identities = 143/266 (53%), Positives = 178/266 (66%), Gaps = 5/266 (1%)

Query: 15  LGIIGGSGLYEFPGLTDPEEFPVETPYGPPSAPPVVGTVGGRWVAFLARHGTGHRIPPSR 74
           LG+IGGSG+Y+  GL +     VETP+G PS   + G + G+ + FL RHG GHRIPPS 
Sbjct: 10  LGVIGGSGVYDIDGLENQRWVKVETPFGDPSDELLTGELNGQKLVFLPRHGRGHRIPPSE 69

Query: 75  IPVRANLYALKALGVTEVVSVSAVGSLREEYAPGHLVVPDQIIDRTRGGRPATFFSSGVV 134
           +  RAN+YALKALGVTE++SVSAVGSL+E   PG  VV DQ IDRT   R  +FF +G+V
Sbjct: 70  LNFRANIYALKALGVTEILSVSAVGSLKEHLPPGTFVVIDQFIDRT-FARNKSFFGTGLV 128

Query: 135 VHVSLADPYCPRLRAALTDAARAAHPTVHPAGTYLCMEGPQFSTRAESQLYRAWGMDVIG 194
            HV+L  P C RL   + +A           GTY+ MEGPQFST+AES+LYR+WG DVIG
Sbjct: 129 AHVALGHPVCGRLGDLIEEALVELKVPHQRRGTYMVMEGPQFSTKAESELYRSWGCDVIG 188

Query: 195 MTAQPEAKLAREAELCYAGLSLVTDYDCWHTGHDSVDARTVAEVMAANVIAARAVLSGLA 254
           MT  PEAKLAREAE+CYA +++VTD+DCWH  HD V    V  V+ AN   AR+++  LA
Sbjct: 189 MTNMPEAKLAREAEMCYATVAMVTDFDCWHPEHDHVTVDAVIRVVVANAGKARSLVKTLA 248

Query: 255 HATAPAD--CA--CHHALDGAVLTDP 276
                 D  CA  CH ALD A++T P
Sbjct: 249 PKLQVRDGLCAQGCHTALDHAIMTAP 274


Lambda     K      H
   0.319    0.135    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 285
Number of extensions: 7
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 299
Length of database: 294
Length adjustment: 26
Effective length of query: 273
Effective length of database: 268
Effective search space:    73164
Effective search space used:    73164
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory