Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate AZOBR_RS16640 AZOBR_RS16640 3-hydroxybutyrate dehydrogenase
Query= metacyc::MONOMER-20835 (262 letters) >FitnessBrowser__azobra:AZOBR_RS16640 Length = 261 Score = 126 bits (316), Expect = 5e-34 Identities = 84/249 (33%), Positives = 128/249 (51%), Gaps = 8/249 (3%) Query: 16 LISGGAAGIGEVLAAAYLEAGAQVHVCDVSESA-LAVFRDKYPGTVATR-----ADVSDA 69 +++G +GIG +A A AGA V + E+A + R R AD+S Sbjct: 9 VVTGSTSGIGLGIARALAGAGADVVLNGFGEAAAIEELRAGLAAEFGVRVGYHGADLSKP 68 Query: 70 AQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHHAV 129 A+I A+ E G +DVLVNNAGI ++ W A I +NL+A + HHA+ Sbjct: 69 AEIAALIGHAEETFGSVDVLVNNAGIQH-VAPVEDFPAERWDAVIALNLSAVFHGTHHAL 127 Query: 130 PMLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALLPG 189 P +K G +L+IASV G + ++ Y A K +VGL K++A E + + NA+ PG Sbjct: 128 PGMKRRGWGRILNIASVHGHVASVNKSAYVAAKHGVVGLTKTVALETAGTGVTCNAICPG 187 Query: 190 IVEGPRMDGVIRARAEQVGVPEAEMRQEYLN-KISLKRMVTAEDVAAMALFLCSPAARNV 248 V P + I A A +PE + + E L K VT +++ +A+FLCS +A + Sbjct: 188 WVLTPLVQKQIDAIASTKNIPEPQAKAELLGAKQPSGAFVTPDELGGLAVFLCSDSAAQM 247 Query: 249 TGQAISVDG 257 TG ++ +DG Sbjct: 248 TGASLLMDG 256 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 261 Length adjustment: 25 Effective length of query: 237 Effective length of database: 236 Effective search space: 55932 Effective search space used: 55932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory