Align 2-deoxy-D-ribose dehydrogenase α subunit (characterized)
to candidate AZOBR_RS27485 AZOBR_RS27485 oxidoreductase
Query= metacyc::MONOMER-20832 (151 letters) >FitnessBrowser__azobra:AZOBR_RS27485 Length = 206 Score = 117 bits (292), Expect = 1e-31 Identities = 62/149 (41%), Positives = 84/149 (56%), Gaps = 1/149 (0%) Query: 1 MELRINQKAYQVDADADTPLLWVIRDDLGLTGTKYGCGLAQCGACSVLVDGNVVRSCVTP 60 + R+N + +D DA LL ++R+ LGL G K GC QCGAC+V +DG V SC+T Sbjct: 54 LSFRVNGRPTALDVDARASLLDLLRERLGLVGAKKGCDHGQCGACTVHLDGRRVASCLTM 113 Query: 61 VAGVVGREITTIEAIETDEVGKRVVATWVEHQVAQCGYCQSGQVMAATALLKHTPAPSKA 120 A GR++TTIE I + +++H QCGYC GQ+MAA A +K A + Sbjct: 114 AAKADGRDVTTIEGIAGANGLHPMQQAFIDHDALQCGYCTPGQIMAAIACVKEGHASTPE 173 Query: 121 QIDAAMI-NLCRCGTYNAIHAAVDDLAKQ 148 QI M N+CRCG Y I AA++ Q Sbjct: 174 QIKEYMSGNICRCGAYVGIVAAIEQAVPQ 202 Lambda K H 0.320 0.134 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 113 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 151 Length of database: 206 Length adjustment: 19 Effective length of query: 132 Effective length of database: 187 Effective search space: 24684 Effective search space used: 24684 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory