Align ABC transporter for L-Fucose, permease component 2 (characterized)
to candidate AZOBR_RS27985 AZOBR_RS27985 ABC transporter permease
Query= reanno::Smeli:SM_b21105 (288 letters) >FitnessBrowser__azobra:AZOBR_RS27985 Length = 280 Score = 180 bits (457), Expect = 3e-50 Identities = 97/270 (35%), Positives = 156/270 (57%), Gaps = 11/270 (4%) Query: 18 HLAGLFLAMLVICLPGLWIVLSSLRPTVEIMAKPPVWIPETLSLDAYRAMFSGAGQGGVP 77 H A L L +LV+ P W+V +LRP ++ +++P +L+ + A++ QG P Sbjct: 21 HAAALALLLLVL-FPFAWMVQMALRPADAVLDDAVLFLP---TLENFVALW----QGHFP 72 Query: 78 VWDYFRNSLIVSVTSTVIALAIGLSGGYAFARYRFKAKSAIFLGFMLTRAVPGIALSLPL 137 F NS++VS ST +LA+G+ Y R+RF+A+ + L + TR P IAL++P Sbjct: 73 --KSFLNSVLVSSLSTAASLALGVPAAYVLTRWRFRARRRVALWILATRMAPPIALTIPF 130 Query: 138 FMLYARTGIIDTHFSLILTYVALNVPFTIWLIDGFFRQVPKDLAEAAQIDGCTPWQAFWQ 197 F+ Y G+ D+ L L Y+ N+ +W + FF +P+ L EAA IDGC WQAF + Sbjct: 131 FLAYRWVGLQDSVVGLALIYMTFNISIVVWFMQTFFAAIPRSLEEAAWIDGCGVWQAFRR 190 Query: 198 VEFPLAGPGIASAGIFAFLTSWNEYALASQITRSVNSKTLPVGLLDYTAEFTIDWRGMCA 257 V PLA PG+A+ +F F+ SWN++ A +TR+ N+ T PV + ++ +W + A Sbjct: 191 VTLPLAAPGLAATAVFCFIFSWNDFFFALILTRT-NAVTAPVAITNFLQYEGWEWGKIAA 249 Query: 258 LAVVMIVPALTLTFIIQKHLVSGLTFGAVK 287 ++++P L T +++K+LV GLT G +K Sbjct: 250 AGTLVMLPVLAFTLLVRKYLVRGLTAGGLK 279 Lambda K H 0.328 0.141 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 280 Length adjustment: 26 Effective length of query: 262 Effective length of database: 254 Effective search space: 66548 Effective search space used: 66548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory