Align SDR family oxidoreductase (characterized, see rationale)
to candidate AZOBR_RS04635 AZOBR_RS04635 oxidoreductase
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__azobra:AZOBR_RS04635 Length = 247 Score = 264 bits (674), Expect = 1e-75 Identities = 138/248 (55%), Positives = 176/248 (70%), Gaps = 6/248 (2%) Query: 5 TGRLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASIAGVETHL-LDV 63 TGRL GK L+T A QG+GRA FAREGA V+A + + +E+L I T + LDV Sbjct: 2 TGRLDGKRALVTGAGQGMGRAIALAFAREGASVVAASRTLSKMEDLPRIDSKITPVALDV 61 Query: 64 TDDDAIKALVAKVGTVDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHTIRAVLPG 123 TD A++ +VA+ G +D+L N AG+V G IL+C D+ W S + N +MFHTIRA LPG Sbjct: 62 TDPAAVRRVVAEAGPLDILVNNAGWVHNGTILDCSDEDWARSLDQNVTSMFHTIRAALPG 121 Query: 124 MLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRCNAICPGT 183 M+ ++ GSIVN+AS ASS+ GVANR AYG SKAAV+GLTK+VA DF+ G+RCNA+CPGT Sbjct: 122 MIERRQGSIVNVASVASSLTGVANRTAYGTSKAAVIGLTKAVARDFIGAGVRCNALCPGT 181 Query: 184 IESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLASDESNFTTG 243 SPSL +RI + A G +RA F+ARQPMGR+G EE+AA A+YLASDES F TG Sbjct: 182 THSPSLEERIQSSADPEG-----MRAQFIARQPMGRLGTVEEMAAAAVYLASDESGFMTG 236 Query: 244 SIHMIDGG 251 S+ + DGG Sbjct: 237 SLLVADGG 244 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 247 Length adjustment: 24 Effective length of query: 230 Effective length of database: 223 Effective search space: 51290 Effective search space used: 51290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory