Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate AZOBR_RS25405 AZOBR_RS25405 C4-dicarboxylate ABC transporter
Query= SwissProt::Q9HU18 (331 letters) >FitnessBrowser__azobra:AZOBR_RS25405 Length = 345 Score = 153 bits (386), Expect = 7e-42 Identities = 106/340 (31%), Positives = 169/340 (49%), Gaps = 13/340 (3%) Query: 1 MLKHTAKALVCALSLTVAGIVQAADPIVI------KFSHVVAEHTPKGQGALLFKKLVEE 54 ML T L AL+L A V +A K S V + P +GA + +LV E Sbjct: 1 MLTRTRPLLAAALTLFGALAVLSAPAEAAEYKSEYKLSVVGSRPIPIAEGAYRWAELVTE 60 Query: 55 RLPGKVKVEVYPNSSLFG--DGKEMEALLLGDVQIIAPSLAKFEQYTKKLQIFDLPFLFD 112 + G++ V+VYP SSL G + +E L G + ++ S K+ +F LPFLF Sbjct: 61 KTRGRITVKVYPGSSLVGGDNTREFTGLRQGSIDLLVNSTINLSPTVKEANLFSLPFLFP 120 Query: 113 NIQAVDRFQQSPQGKELLTSMQDKGITGLGYWHNGMKQLS-ANKPLREPKDARGLKFRVQ 171 + +A D Q GK L ++ K + L NG + LS + KP+R P D +GLK RV Sbjct: 121 DSKAFDAVAQGEPGKALFGILESKQVVPLAVGENGFRALSNSKKPVRTPDDLKGLKVRVV 180 Query: 172 ASKVLEEQFKAVRANPRKMSFAEVYQGLQTGVVNGTENPWSNIYSQKMHEV-QKYITESD 230 S + + F A+ ANP +M+FA++ L TG V+G ENP S + K++ + QK++T + Sbjct: 181 GSPIFNDIFTALGANPTQMTFADLQPALSTGAVDGQENPVSLFLAAKLYGLNQKHLTLWN 240 Query: 231 HGVLDYMVITNTKFWNGLPEDVRGVLAKTMDEVTVEVNK-QAEALNQGDKQRIVEAKTSE 289 + + I N + W + R ++ + + E + L D+ + + Sbjct: 241 YIADAGLFIANKEVWESWTPEDRALVREAAVQAAAEFTALSRQGLTAEDRSALTALASHG 300 Query: 290 IIELTPEQR--AEWRKAMQPVWKKFEGEIGADLIKAAEAA 327 + +T EQ +RKA +PV++K+ +GADL++ AE A Sbjct: 301 VQVVTTEQTDVEAFRKATRPVYEKWTQTVGADLVRKAEEA 340 Lambda K H 0.316 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 345 Length adjustment: 28 Effective length of query: 303 Effective length of database: 317 Effective search space: 96051 Effective search space used: 96051 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory