GapMind for catabolism of small carbon sources

 

Aligments for a candidate for dgoD in Azospirillum brasilense Sp245

Align L-arabinonate dehydratase; ArDHT; D-fuconate dehydratase; Galactonate dehydratase; L-arabonate dehydratase; EC 4.2.1.25; EC 4.2.1.67; EC 4.2.1.6 (characterized)
to candidate AZOBR_RS31260 AZOBR_RS31260 dihydroxy-acid dehydratase

Query= SwissProt::B5ZZ34
         (579 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS31260 AZOBR_RS31260
           dihydroxy-acid dehydratase
          Length = 608

 Score =  439 bits (1129), Expect = e-127
 Identities = 241/539 (44%), Positives = 338/539 (62%), Gaps = 15/539 (2%)

Query: 9   RKLRSQEWYGGTSRD---VIYHRGWLKNQGYPHDLFDGRPVIGILNTWSDMTPCNGHLRE 65
           R+LRS+ W+          +Y   +L       +L  G P+IGI  T SD++PCN H   
Sbjct: 17  RRLRSRAWFDNPDNPDMTALYLERYLNFGLTREELQSGAPIIGIAQTGSDLSPCNRHHLV 76

Query: 66  LAEKVKAGVWEAGGFPLEVPVFSASENTFRPTAMMYRNLAALAVEEAIRGQPMDGCVLLV 125
           LAE+++ G+  AGG  +E PV    E   RPTA + RNLA L + E + G P+DG VL +
Sbjct: 77  LAERLREGIRTAGGIAIEFPVHPIQETGKRPTASIDRNLAYLGLVEVLHGYPLDGVVLTI 136

Query: 126 GCDKTTPSLLMGAASCDLPSIVVTGGPMLNGYFRGERVGSGTHLWKFSEMVKAGEMTQAE 185
           GCDKTTP+ LM AA+ ++P+I ++ GPMLNG+FRGER GSGT +WK  +M+ AGE+    
Sbjct: 137 GCDKTTPACLMAAATVNIPAIALSVGPMLNGWFRGERTGSGTIVWKARQMMAAGEIDYQG 196

Query: 186 FLEAEASMSRSSGTCNTMGTASTMASMAEALGMALSGNAAIPGVDSRRKVMAQLTGRRIV 245
           F+E  AS + S+G CNTMGTASTM S+AE LGM L G+AAIP     R+     TG+RIV
Sbjct: 197 FIELVASSAPSTGYCNTMGTASTMNSLAEVLGMQLPGSAAIPAPYRERQQADYETGKRIV 256

Query: 246 QMVKDDLKPSEIMTKQAFENAIRTNAAIGGSTNAVIHLLAIAGRVGIDLSLDDWDRCGRD 305
           +MV++DLKPS+I+T+ AF NAI  N+AIGGSTNA IH+ AIA  +G+ L+++DW   G D
Sbjct: 257 EMVREDLKPSDILTRDAFLNAIVVNSAIGGSTNAPIHINAIAKHIGVPLTVEDWQTHGHD 316

Query: 306 VPTIVNLMPSGKYLMEEFFYAGGLPVVLKRLGEAGLLHKDALTVSGETVWDEVKDVVNWN 365
           VP +VNL P+G+YL E+F  AGG+P V+ +L   GL+ + A TV+G T+ +  +     +
Sbjct: 317 VPLLVNLQPAGEYLGEDFHRAGGVPAVVAQLMGKGLIREGAPTVNGRTIGENCRRQPILD 376

Query: 366 EDVILPAEKALTSSGGIVVLRGNLAPKGAVLKPSAASPHLL-----------VHKGRAVV 414
             VI P ++ L  + G VVLRGNL    A++K S  S                 +G+ VV
Sbjct: 377 TRVIHPIDEPLMPNAGFVVLRGNLF-GAAIMKTSVISDEFRERYLSNPQDPEAFEGKVVV 435

Query: 415 FEDIDDYKAKINDDNLDIDENCIMVMKNCGPKGYPGMAEVGNMGLPPKVLKKGILDMVRI 474
           F+  +DY  +I+D +L ID   I+V++  GP GYPG AEV NM  P  ++K+G+  +  I
Sbjct: 436 FDGPEDYHHRIDDPSLGIDAYTILVIRGTGPIGYPGAAEVVNMRPPATLIKQGVHSLPCI 495

Query: 475 SDARMSGTAYGTVVLHTSPEAAVGGPLAVVKNGDMIELDVPNRRLHLDISDEELARRLA 533
            D R SGT+    +L+ SPEAA GG LA++++GD + +D+      + I + ELA R A
Sbjct: 496 GDGRQSGTSGSPSILNASPEAAAGGGLALLRSGDRVRIDLRRGSADILIPEGELADRRA 554


Lambda     K      H
   0.318    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 985
Number of extensions: 66
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 579
Length of database: 608
Length adjustment: 37
Effective length of query: 542
Effective length of database: 571
Effective search space:   309482
Effective search space used:   309482
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory