Align Inner membrane ABC transporter permease protein YjfF (characterized)
to candidate AZOBR_RS31200 AZOBR_RS31200 sugar ABC transporter permease
Query= SwissProt::P37772 (331 letters) >FitnessBrowser__azobra:AZOBR_RS31200 Length = 325 Score = 378 bits (971), Expect = e-110 Identities = 193/322 (59%), Positives = 234/322 (72%) Query: 1 MIKRNLPLMITIGVFVLGYLYCLTQFPGFASTRVICNILTDNAFLGIIAVGMTFVILSGG 60 MI R LPL++T V V+G+L C QFP FAS RV+ N+LTDNAFLGI AVGMTFVILSGG Sbjct: 1 MIHRFLPLLVTSAVLVVGFLLCAAQFPNFASLRVVGNLLTDNAFLGITAVGMTFVILSGG 60 Query: 61 IDLSVGSVIAFTGVFLAKVIGDFGLSPLLAFPLVLVMGCAFGAFMGLLIDALKIPAFIIT 120 IDLSVG+VI FT V LA +I G P+ AF + L + FGA MG +I ++P FI+T Sbjct: 61 IDLSVGAVIGFTTVLLAVLIEQGGWHPVSAFAVALAVAGGFGAAMGAVIHVFQMPPFIVT 120 Query: 121 LAGMFFLRGVSYLVSEESIPINHPIYDTLSSLAWKIPGGGRLSAMGLLMLAVVVIGIFLA 180 LAGMF RG+ +++S +SIPINHP+Y L LA + GGG+L+ LLML VV + A Sbjct: 121 LAGMFVARGLGFVLSTDSIPINHPLYAELGDLALRFDGGGKLTLPALLMLGVVAAAVVCA 180 Query: 181 HRTRFGNQVYAIGGNATSANLMGISTRSTTIRIYMLSTGLATLAGIVFSIYTQAGYALAG 240 H TRFG +YA+GGN SA LMG+ TT+ +Y LS LA LAGIVFS+YT AGY+LA Sbjct: 181 HWTRFGANLYALGGNRQSAELMGVPVGRTTVAVYALSGLLAGLAGIVFSLYTGAGYSLAA 240 Query: 241 VGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQGLIQTYINFDGTLSSWWTKIAIGIL 300 GVELD I +VVIGGT L+GG G V+GT GV IQGLIQTYI FDG+LSSWWTKIAIG+L Sbjct: 241 TGVELDTITAVVIGGTQLTGGYGYVIGTFIGVLIQGLIQTYITFDGSLSSWWTKIAIGVL 300 Query: 301 LFIFIALQRGLTVLWENRQSSP 322 LF+FI LQ+GL +W R +P Sbjct: 301 LFVFILLQKGLLAVWTGRGGAP 322 Lambda K H 0.329 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 445 Number of extensions: 30 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 325 Length adjustment: 28 Effective length of query: 303 Effective length of database: 297 Effective search space: 89991 Effective search space used: 89991 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory