Align Large component of TRAP-type D-gluconate transporter (characterized)
to candidate AZOBR_RS04640 AZOBR_RS04640 C4-dicarboxylate ABC transporter
Query= reanno::azobra:AZOBR_RS15920 (426 letters) >FitnessBrowser__azobra:AZOBR_RS04640 Length = 426 Score = 266 bits (679), Expect = 1e-75 Identities = 150/419 (35%), Positives = 230/419 (54%), Gaps = 9/419 (2%) Query: 1 MALAVFLSSLFGLMLLGMPIAFALMLTGVALMVHLDFFDAQLVAQNMLSGADNYPLMAVP 60 +A AVFL L+GMP+AFA+ ++GV + + Q +S N+ L+AVP Sbjct: 6 LAFAVFL-------LIGMPVAFAIGISGVLFFLQHPELPFTIPLQVTVSQTQNFALLAVP 58 Query: 61 FFILAGELMNAGGISQRIINLAVSLVGHIRGGLGYVTIGASVMLASLSGSAIADTAALAT 120 FI+AG MN GI++ ++NLA GH++GGL ++I S ++ +SGSAIAD A + Sbjct: 59 LFIMAGNYMNRSGITESLLNLASVATGHLKGGLAQISIVLSALMGGVSGSAIADAAMQSR 118 Query: 121 LLIPMMRDNGYPVPRSAGLIASGGIIAPIIPPSMPFIIFGVTTNTSISGLFMAGIVPGLL 180 +L M G +AG+I+ ++ P+IPP + I+FG SI LF AG P LL Sbjct: 119 ILGEEMTKRGMSRGFTAGVISFTSLLTPLIPPGIGMILFGTIGQVSIGRLFAAGFAPALL 178 Query: 181 MGAGL--VITWMFVVRGMTVKLQPKASWGERRTALVEGVWALALPVIIIGGLRGGIFTPT 238 +G + + + RG + + +AS E +AL GVWAL PVI++ GLR GIFTP+ Sbjct: 179 LGIAMSAAVWYTSNKRGYPAEREKRASLAEVGSALKGGVWALLFPVILLVGLRMGIFTPS 238 Query: 239 EAAVVAAVYSLVVALFVYRQVTLKDLVPLLVQAARTTSTVMFLCAAALVSSYMVTLADLP 298 E A +Y+L + VYR++ K V L + + MFL + + + SY + +P Sbjct: 239 EIGAFAVLYALFIGFVVYRRLKAKSFVEALEVSLADVGSAMFLISLSAIFSYGIVFERIP 298 Query: 299 QQMNEMLAPLLHEPKLLMVAITLLLLAVGTVMDLTPTILVLGPVLTPLAAAAGIDPTYFG 358 + + L L +L+MV I LL+LA G +D T I+++ P+ P A G DP +FG Sbjct: 299 EVIASSLTSLTDNVQLVMVLIVLLVLAAGLFIDATVIIIMMTPIFLPAVRAMGGDPVHFG 358 Query: 359 VMFVLTGTLGLIHPPVCTVLNVVCGVARISLESATRGIWPFLLTYLLLLCLLIAVPEIV 417 V+F++ T+G PPV + VC + ++S+ + R P ++ L LLI VPE + Sbjct: 359 VVFIVAATIGNFTPPVGAAMFTVCSILKVSVGAYVRESLPLMIAIGLTTILLIFVPEFI 417 Lambda K H 0.328 0.142 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 426 Length adjustment: 32 Effective length of query: 394 Effective length of database: 394 Effective search space: 155236 Effective search space used: 155236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory