Align ABC transporter for D-glucosamine, periplasmic substrate-binding component (characterized)
to candidate AZOBR_RS10265 AZOBR_RS10265 amino acid ABC transporter substrate-binding protein
Query= reanno::pseudo3_N2E3:AO353_21710 (282 letters) >FitnessBrowser__azobra:AZOBR_RS10265 Length = 279 Score = 84.7 bits (208), Expect = 2e-21 Identities = 81/268 (30%), Positives = 118/268 (44%), Gaps = 12/268 (4%) Query: 3 RRLSLFTACVFLFAATASAVGIAQAA----DSRLDNVLKRGHLIVGTGSTNAPWHFQGA- 57 RRLS+ + L AA S ++ AA +SRLD V + G L V F+ + Sbjct: 9 RRLSIALTALALHAALQSVFLVSGAAPVRAESRLDRVQRNGLLRVCIWPDYYAISFRSSY 68 Query: 58 DGKLQGFDIDIGRMVAKGLFNDPSKVEFVVQSSDARIPNLLTDKVDMSCQFITVTASRAQ 117 G+LQG DID+ R A L ++V FV + +LL+D+ D+ I VTA+RA+ Sbjct: 69 SGELQGLDIDMARAFAHDL---GARVSFVESGFPNFVADLLSDRCDIGMFGIGVTAARAE 125 Query: 118 QVAFTLPYYREGV-GLLLPANSKYKEIEDLKAAGDSVTVAVLQNVYAEELVHQALPKAKV 176 ++AF+ PY R G+ + + + +DL D + VAV + ++ A KA V Sbjct: 126 KIAFSQPYLRSGIYAVSSQTHPRILRWDDLDQ--DGMVVAVQKGTVMDDYASLAFRKASV 183 Query: 177 DQYDSVDLMYQAVNSGRADTAATDQS-SVKYLMVQNPGRYRSPTYAWSPQTYACAVKRGD 235 + V SGRAD TD + L +P YA AV GD Sbjct: 184 RIVSGPLEREEEVQSGRADAFLTDYPYGQRMLAFHQWAHLIAPENPVQTTPYAYAVAPGD 243 Query: 236 QDWLNFVNTVLHEAMTGVEFPTYAASFK 263 WL+ VN + AA F+ Sbjct: 244 PLWLDRVNRFVDAVKRDGRLEAAAARFR 271 Lambda K H 0.319 0.133 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 279 Length adjustment: 26 Effective length of query: 256 Effective length of database: 253 Effective search space: 64768 Effective search space used: 64768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory