Align ABC transporter for D-Glucosamine, permease component 2 (characterized)
to candidate AZOBR_RS25585 AZOBR_RS25585 ABC transporter permease
Query= reanno::Smeli:SM_b21220 (293 letters) >FitnessBrowser__azobra:AZOBR_RS25585 Length = 301 Score = 214 bits (544), Expect = 3e-60 Identities = 117/273 (42%), Positives = 169/273 (61%), Gaps = 6/273 (2%) Query: 10 AWLLMLPLLVVMTAVIGWPLVDTVRLSFTDAKLVGTEG-GFVGTANYIKMLGGSNFQRAL 68 AWL +LP+L+V+ V GWPL TV SFTDA L EG VG NY+ ++ + RA+ Sbjct: 18 AWLFLLPMLIVLAGVAGWPLFRTVFFSFTDATLATLEGFQGVGLDNYLWLMRDPVWWRAV 77 Query: 69 VTTTWFAVISVAAEMVLGVLAALLLNQQFRGRTALRALMILPWALPTVVNATLWRLIYNP 128 T F V+SV E LG+ AL+LN GR LRA +++PWA+PTVV+A +W +++ Sbjct: 78 WNTLVFTVVSVGIETALGLGIALILNAHLPGRGLLRAAVLIPWAIPTVVSAQMWGWMFHD 137 Query: 129 EYGALNAALTQLGLLDSYRSWLGEPGTALAALIVADCWKNFPLVALIALAALQAVPRDIT 188 YG +NA L LGL+ R+W +P AL +I D WK+ P +AL+ LAALQ +PRD+ Sbjct: 138 LYGVVNAILMGLGLIAEPRAWTADPDLALPVVIAVDVWKSTPFMALLILAALQMLPRDLY 197 Query: 189 AASLVDGAGPFNRFRFVIMPYLAGPLLVALVLRTIEAFKVFDIIWVMTRGGPANSTRTLS 248 A+ VDG P F + +P + L+VA++ RT++A +VFD+++V+T G + ST ++S Sbjct: 198 EAARVDGVHPVKVFVRITLPLIRPALMVAVLFRTLDALRVFDLMYVLT--GNSRSTMSMS 255 Query: 249 ILVYQEAFSFQRAGSGASLALIVTLLVTILAAA 281 + Q FQ G G++ A TLLV +LA A Sbjct: 256 VYARQYLIDFQDVGYGSAAA---TLLVLVLAVA 285 Lambda K H 0.326 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 301 Length adjustment: 26 Effective length of query: 267 Effective length of database: 275 Effective search space: 73425 Effective search space used: 73425 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory