Align ADP-specific glucokinase (EC 2.7.1.147) (characterized)
to candidate AZOBR_RS27950 AZOBR_RS27950 transcriptional regulator
Query= BRENDA::Q8R8N4 (312 letters) >FitnessBrowser__azobra:AZOBR_RS27950 Length = 392 Score = 136 bits (342), Expect = 9e-37 Identities = 80/257 (31%), Positives = 130/257 (50%), Gaps = 16/257 (6%) Query: 56 GISVKDVKSMGIGVPGVADNEKGIVIRAVNLFWTKVPLAKEIRKYIDLPIYMENDANVAA 115 G + + +G+G+P + D E G ++ A NL W P+ + + + P++++ND AA Sbjct: 140 GAATPPLCGIGVGIPALMDRE-GRLVLAPNLGWRDTPIRPLLEEALGAPVHVDNDTKAAA 198 Query: 116 LAEATFGAGRGSKSSVTITLGTGVGSGFILDGKIYSGAHHFAPEIGHMVIGDNGIRCNCG 175 +AE FGA RG + V +T +GVG G G++Y GA FA EIGH+ I G C CG Sbjct: 199 MAERLFGACRGVEDFVYLTGHSGVGGGLFFGGRLYRGAQGFAGEIGHLTIVPGGRACGCG 258 Query: 176 KIGCFETYASATALIREGKKAAKRNPNTLILKFANGDIEGITAKNVIDAAKQYDEEALKI 235 K GC ETY S T+++ + + + P D+ A AA+ D + Sbjct: 259 KRGCLETYVSETSILAQAAERGRALP----------DLWAAAA-----AARDGDPVVRTL 303 Query: 236 FEEYVKYLAVGIVNIINLFDPEVIILGGGVANAGDFLLKPLKKEVAENILFKELPYADIR 295 EE +L + +++NL +P +++LGG +A +F+L L + E+ L + Sbjct: 304 LEEAGSHLGFALSHLVNLANPGLVVLGGNLAIVAEFILPALNAALGEHALEPLRRDLRLL 363 Query: 296 KAELGNDAGIIGAAILS 312 + LG DA +G L+ Sbjct: 364 VSPLGPDAVPMGGIALA 380 Lambda K H 0.318 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 312 Length of database: 392 Length adjustment: 29 Effective length of query: 283 Effective length of database: 363 Effective search space: 102729 Effective search space used: 102729 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory