GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagF in Azospirillum brasilense Sp245

Align N-Acetyl-D-Glucosamine phosphotransferase system transporter, component of N-acetyl glucosamine-specific PTS permease, GlcNAc IIBC/GlcNAc I-HPr-IIA (characterized)
to candidate AZOBR_RS30470 AZOBR_RS30470 phosphoenolpyruvate-protein phosphotransferase

Query= TCDB::Q9HXN5
         (842 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS30470 AZOBR_RS30470
           phosphoenolpyruvate-protein phosphotransferase
          Length = 590

 Score =  331 bits (848), Expect = 8e-95
 Identities = 218/570 (38%), Positives = 318/570 (55%), Gaps = 24/570 (4%)

Query: 276 PAAVAG-TLAGVCASPGLASGP--LARLGAISLPADD-GRHRPEEQHLALDQALQRVRDD 331
           PAA  G +L G+  SPG+A GP  +   GAI +P       + E +      A  + R  
Sbjct: 6   PAAGQGRSLRGLGVSPGIAIGPAHVVESGAIRVPEYTLTADQVEAEAARFADACGKARRQ 65

Query: 332 VQGSLQQARL---GGDENEAAIFSAHLALLEDPGLLDAADMLIDQGVGAAHAWHRAIQAQ 388
           ++    +A +      E    +  AHLA++ +  L    +  I Q +  A A   A+QA+
Sbjct: 66  IRKLKAKALVLPGSASEEIGFLLDAHLAMVTNSRLTRGVERRIQQELVNAEA---AVQAE 122

Query: 389 ----CEILQALGNLLLAERANDLRDLEKRVLRVLLGDT--APLRVPAGAIVAAREITPSD 442
                +   ++ +  LA R  D+R++ +R++R L+     A   +  GA++ A E+TP+D
Sbjct: 123 IATIAQTFASMEDSYLAGRIADVREVGRRLIRNLMRHEYQAFSMLNPGAVILAEELTPAD 182

Query: 443 LAPLVDAGAAGLCMAEGGATSHVAILARSKGLPCLVALGAGLLELEEGRQVVLDAGQGRL 502
            A L     AG     GGA  H AI+ARS G+P ++ +G  L  L+ G  V++D  QGR+
Sbjct: 183 TALLDPRRVAGFATVLGGAEGHTAIMARSLGIPAVLGVGGLLAGLKNGITVIVDGVQGRV 242

Query: 503 ELSPDARRLEQVALQVAQREEQRRRQQADAQREALTRDGRRIEIGANVASPREAAEAFAN 562
            + P    LE    + A+RE +R + +   +  A+TRD   + + AN+  PR+   A  N
Sbjct: 243 IIDPTPEVLEDYRQRRAEREREREQLKGLRKLPAVTRDNTAVTLQANLELPRDLDHALEN 302

Query: 563 GADGVGLLRTEFLFLERRAAPDEEEQRNAYQEVLDAMGQRKVIIRTIDVGGDKHLDYLPL 622
           GA G+GLLRTEFLF+ R   PDE+EQ    + +++ MG R V  RT+DVGG+K   ++  
Sbjct: 303 GAQGIGLLRTEFLFMNRDQLPDEDEQYTVLRSIVEGMGGRTVTARTMDVGGEKLAGWMAG 362

Query: 623 PVEE--NPALGLRGIHLGQARPELLDQQLRALLRVEPLERCRILLPMVSEVDELRAIRRR 680
              E  NPALGLR + LG   P+LL+ QL A+LR       RILLPM+  V E++ +R  
Sbjct: 363 RYGEPANPALGLRAVRLGLREPKLLETQLAAMLRAGVHGPLRILLPMICSVAEVQRVREM 422

Query: 681 LGELATQL---GI---ERLPELGVMIEVPSAALLADQLAEHADFLSIGTNDLSQYALAMD 734
           +G++A +L   G+   + LP +GVM+EVP AAL AD LA  ADF SIGTNDL+QY LA+D
Sbjct: 423 MGQVARRLRRRGVPIADPLPPVGVMVEVPGAALSADALAYAADFFSIGTNDLTQYTLAID 482

Query: 735 RCHAGLADRIDALHPALLRLIAQTCAGAARHGRWVGVCGALASDPLATPVLVGLGVEELS 794
           R    +A   D LHPA+LRLI  T   A R    V VCG +A D   T +L+GLGV +LS
Sbjct: 483 RGDEQVASLYDPLHPAVLRLIQFTIEAALRARIPVSVCGEIAGDSRYTALLLGLGVRDLS 542

Query: 795 VGPNLVGEIKTRVRQLDAAECRRHAQALLD 824
           + P  +  +K R+R+LD  E  R A+ ++D
Sbjct: 543 MVPPAIPLVKRRIRKLDLQEATRRARVIMD 572


Lambda     K      H
   0.319    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1157
Number of extensions: 45
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 842
Length of database: 590
Length adjustment: 39
Effective length of query: 803
Effective length of database: 551
Effective search space:   442453
Effective search space used:   442453
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory