Align Glucose kinase (characterized, see rationale)
to candidate AZOBR_RS05405 AZOBR_RS05405 glucokinase
Query= uniprot:Q8P6M4 (344 letters) >FitnessBrowser__azobra:AZOBR_RS05405 Length = 311 Score = 181 bits (460), Expect = 2e-50 Identities = 116/322 (36%), Positives = 165/322 (51%), Gaps = 28/322 (8%) Query: 23 LAADVGGTHVRVGRVS----HGADAPIELSQYRTYRCADHASLDAILADFL-------RD 71 L AD+G T+ R G + HG+ R RCAD SL+A +L R Sbjct: 1 LVADIGATNARFGLIDGTGIHGS---------RVLRCADFPSLEAAALAYLGGVAHDARP 51 Query: 72 SRAVDAVVIASAGVALDDGRFISNNLPWTIAPRQLRDTLGVRAVHLVNDFEAVAYAAPQM 131 SR A+ G A+ + N W+ + ++R LG+ + ++NDF AVA + P++ Sbjct: 52 SRGAFAIAGPVTGDAV-----LMTNRGWSFSTAEVRGKLGLERLAVINDFTAVALSVPRL 106 Query: 132 EQRAVVQLSGPTPRHAQPGGPILVVGPGTGLGAAVWINGPRQPTVLATEAGQVALASNDP 191 V Q+ P PG + VVGPG+GLG + + G T LA E G V +A Sbjct: 107 TAADVRQVGEGAP---VPGRVVGVVGPGSGLGVSGLVPGAEGWTALAAEGGHVTMAPVSD 163 Query: 192 DTAQVLRILARDASYLPIEHVLSGPGLRNLYLALCELHAATPIHPLPADITHAALHSDDA 251 + VL L + ++ E VLSGPGL NLY ALC L P PA ++ AA + + Sbjct: 164 RESAVLAQLRKSFEHVSAERVLSGPGLVNLYQALCVLDHQEPEPFTPAQVSDAATANTNP 223 Query: 252 LARRCLQLFCALLGSAVGDMALAYGASGGVYLAGGILPSIGQFLAASDFRERFLAKGRMR 311 +++FCA+LG+ G++AL GA GG+Y+AGGI+P +G S FR+RF+ KGRMR Sbjct: 224 HCVEAVEMFCAMLGTVAGNLALTLGARGGIYIAGGIVPKLGTLFTHSRFRKRFMEKGRMR 283 Query: 312 PVLERIPVKLVEHGQLGVLGAA 333 L IP ++ H LG A Sbjct: 284 DFLAPIPTYVITHELPAFLGLA 305 Lambda K H 0.321 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 311 Length adjustment: 28 Effective length of query: 316 Effective length of database: 283 Effective search space: 89428 Effective search space used: 89428 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory