Align tartronate semialdehyde reductase 2 (characterized)
to candidate AZOBR_RS07955 AZOBR_RS07955 tartronate semialdehyde reductase
Query= ecocyc::G6278-MONOMER (292 letters) >FitnessBrowser__azobra:AZOBR_RS07955 Length = 302 Score = 407 bits (1046), Expect = e-118 Identities = 202/291 (69%), Positives = 239/291 (82%) Query: 1 MKLGFIGLGIMGTPMAINLARAGHQLHVTTIGPVADELLSLGAVSVETARQVTEASDIIF 60 M +GFIGLGIMG PMA +LA AGH L V I P ++LL+ GA + ++R+V + +DI+F Sbjct: 1 MNVGFIGLGIMGRPMAGHLADAGHTLFVYDINPAPEDLLAKGATACGSSREVAQKADIVF 60 Query: 61 IMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVS 120 MVPDTP V+ LFG NG + GK +VDMSSISPIETK FA+++NELG DYLDAPVS Sbjct: 61 TMVPDTPHVQAALFGPNGVAEGLSAGKIVVDMSSISPIETKAFAQRINELGCDYLDAPVS 120 Query: 121 GGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNGDGQTCKVANQIIVALNI 180 GGE+GA+ +L+IMVGG + FE VKPLFE +GKNITLVGGNGDGQT KVANQI+VAL I Sbjct: 121 GGEVGAKAASLTIMVGGPDKAFETVKPLFEKMGKNITLVGGNGDGQTTKVANQIVVALTI 180 Query: 181 EAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQKDLN 240 EAV EALLFASKAGADP +VRQALMGGFASSRILEVHGERM+KRTF+PGF+I LHQKDLN Sbjct: 181 EAVGEALLFASKAGADPAKVRQALMGGFASSRILEVHGERMVKRTFDPGFRIELHQKDLN 240 Query: 241 LALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQALELMANHKL 291 LAL A+AL ++LPNTATCQELFN CAA GG DHS +V+ALEL+ANH++ Sbjct: 241 LALSGARALGVSLPNTATCQELFNACAAQGGKAWDHSGMVRALELLANHEI 291 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 302 Length adjustment: 26 Effective length of query: 266 Effective length of database: 276 Effective search space: 73416 Effective search space used: 73416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate AZOBR_RS07955 AZOBR_RS07955 (tartronate semialdehyde reductase)
to HMM TIGR01505 (2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01505.hmm # target sequence database: /tmp/gapView.6107.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01505 [M=291] Accession: TIGR01505 Description: tartro_sem_red: 2-hydroxy-3-oxopropionate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-131 421.6 3.2 8.5e-131 421.4 3.2 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS07955 AZOBR_RS07955 tartronate semiald Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS07955 AZOBR_RS07955 tartronate semialdehyde reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 421.4 3.2 8.5e-131 8.5e-131 2 291 .] 3 291 .. 2 291 .. 0.99 Alignments for each domain: == domain 1 score: 421.4 bits; conditional E-value: 8.5e-131 TIGR01505 2 vgfiGlGimGkPmsknllkaGyqlvvatleqealdellaaGaesaetakevvedadvivtmvPdsPqve 70 vgfiGlGimG+Pm+ l+ aG+ l v +++ +a ++lla Ga++ ++ +ev+++ad+++tmvPd+P+v+ lcl|FitnessBrowser__azobra:AZOBR_RS07955 3 VGFIGLGIMGRPMAGHLADAGHTLFVYDIN-PAPEDLLAKGATACGSSREVAQKADIVFTMVPDTPHVQ 70 9*****************************.999*********************************** PP TIGR01505 71 evalGenGileaakkGkvlvdmssiaPleskelakavkekGidvldaPvsGGeagaiegtlsimvGGdk 139 + ++G+nG+ e+ Gk++vdmssi+P+e+k +a+ ++e+G d+ldaPvsGGe+ga+ + l+imvGG + lcl|FitnessBrowser__azobra:AZOBR_RS07955 71 AALFGPNGVAEGLSAGKIVVDMSSISPIETKAFAQRINELGCDYLDAPVSGGEVGAKAASLTIMVGGPD 139 ********************************************************************* PP TIGR01505 140 avfdkvkpllealgksivlvGenGaGqtvkvanqvivalnieavsealvlaekaGvdpkavlqalrGGl 208 f+ vkpl+e +gk+i+lvG+nG+Gqt+kvanq++val ieav eal++a+kaG+dp +v+qal+GG+ lcl|FitnessBrowser__azobra:AZOBR_RS07955 140 KAFETVKPLFEKMGKNITLVGGNGDGQTTKVANQIVVALTIEAVGEALLFASKAGADPAKVRQALMGGF 208 ********************************************************************* PP TIGR01505 209 agstvleakkerlldrdfkPGfridlhqkdlalaldaakavgaalPvtavvaellaalradGdgtldhs 277 a+s++le+++er+++r+f+PGfri+lhqkdl+lal a+a+g++lP+ta+++el++a++a+G+ dhs lcl|FitnessBrowser__azobra:AZOBR_RS07955 209 ASSRILEVHGERMVKRTFDPGFRIELHQKDLNLALSGARALGVSLPNTATCQELFNACAAQGGKAWDHS 277 ********************************************************************* PP TIGR01505 278 alvraleklakdkv 291 +vrale+la++++ lcl|FitnessBrowser__azobra:AZOBR_RS07955 278 GMVRALELLANHEI 291 ***********986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (291 nodes) Target sequences: 1 (302 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.35 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory