Align 2-hydroxy-3-oxopropionate reductase; EC 1.1.1.60; Tartronate semialdehyde reductase; TSAR (uncharacterized)
to candidate AZOBR_RS20875 AZOBR_RS20875 oxidoreductase
Query= curated2:P77161 (292 letters) >FitnessBrowser__azobra:AZOBR_RS20875 Length = 299 Score = 129 bits (325), Expect = 6e-35 Identities = 85/280 (30%), Positives = 135/280 (48%), Gaps = 4/280 (1%) Query: 1 MKLGFIGLGIMGTPMAINLARAGHQLHVTTIGPVADELLSLGAVSVETARQVTEASDIIF 60 M++GF+GLG MG+ MA+NL +AGH + V + + G V A +A D +F Sbjct: 1 MQIGFVGLGNMGSAMALNLVKAGHDVRAWNRSKVTQDSVP-GVTLVRRAADAFQA-DAVF 58 Query: 61 IMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVS 120 M+ D P + EV+ + G ++ G T V S+IS + R E G Y+ APV Sbjct: 59 TMLSDDPAIREVIL-DAGLLASARPGLTHVVTSTISVAFARELERLHEEAGLGYVSAPVL 117 Query: 121 GGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGN-GDGQTCKVANQIIVALN 179 G A G L+I+ G V+PL L K + +G N T K+A +++A+ Sbjct: 118 GRPNAAASGQLNILAAGKADAVAAVEPLLASLSKKVWKLGENPARANTAKLACNMMIAMA 177 Query: 180 IEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQKDL 239 IEA++E ++ G D + ++G S R E + ++ +R+F PGFK L KD+ Sbjct: 178 IEAMAEGVVLTESVGLDRADFFELILGTLFSGRAYESYSAQITERSFEPGFKAELALKDM 237 Query: 240 NLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSAL 279 LA +++ + LP +E + G D S + Sbjct: 238 RLATEASNEIGRTLPMLEAVREGLRKAVSAGFGNKDWSIM 277 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 299 Length adjustment: 26 Effective length of query: 266 Effective length of database: 273 Effective search space: 72618 Effective search space used: 72618 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory