Align Probable 5-dehydro-4-deoxyglucarate dehydratase 2; EC 4.2.1.41; 5-keto-4-deoxy-glucarate dehydratase 2; KDGDH 2 (uncharacterized)
to candidate AZOBR_RS23300 AZOBR_RS23300 dihydrodipicolinate synthase
Query= curated2:Q9RDE8 (322 letters) >FitnessBrowser__azobra:AZOBR_RS23300 Length = 304 Score = 81.6 bits (200), Expect = 2e-20 Identities = 82/285 (28%), Positives = 119/285 (41%), Gaps = 16/285 (5%) Query: 34 LTSFHEDGSFDADGYRAYVAERLAAGPGALFPACGTGEFFSLDEDEYRQAVAIAVEETAG 93 +T F DG D +RA V L G + TGE +L +E + VAI+ EE G Sbjct: 13 VTPFTADGEIDEAAFRAQVRFMLQKGVHGVCVGGSTGEGHTLSTEELTRLVAISCEEVDG 72 Query: 94 SVPVVAGTGYGWAQ-ALRFARIAEDAGADALLVMP-HYLTAAPQDGLVAQMERIAAGTRL 151 +VPVVAG + A+ AR E AL V P HY+ +D + +A TR+ Sbjct: 73 AVPVVAGIIVNSTRDAIAKARALEHLPVAALQVTPVHYVFKPDEDATLEHFRTLAGETRM 132 Query: 152 PLIAYQRGQVAYTAES--VRRLTRVPGVIGLKDGHSDLDRLQRAVLAAPDDFLFFNGAAT 209 P++ Y Y + S VR + + VIG+K DL + + L F Sbjct: 133 PIVIYNVVPWNYLSPSLLVRIMKEIDSVIGVKQSAGDLKLMADLLNEQVPGKLVFTA--- 189 Query: 210 AEVQARAYA--AVGVPAYSSAVHAFAPEIANAFLAALRGGDTGTVDKLLRDFYVPLVELR 267 V A Y A+G +A A P + A A++ GD ++ R + Sbjct: 190 --VDALLYPSFALGAHGTIAANPAAVPGVTVALWNAVQAGDHPRALEIHRSLLAFWNTIN 247 Query: 268 -DRVPGYAVSLVKAAARLRGCPVGPVRAPLTDPSPADLAALTTLL 311 D +PG VK + +GC VG R P+ + A A + L Sbjct: 248 GDNLPG----CVKHSLSRQGCEVGVPRQPMPAATEAQKARIDAAL 288 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 322 Length of database: 304 Length adjustment: 27 Effective length of query: 295 Effective length of database: 277 Effective search space: 81715 Effective search space used: 81715 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory