Align mannonate dehydratase (EC 4.2.1.8) (characterized)
to candidate AZOBR_RS31370 AZOBR_RS31370 mannonate dehydratase
Query= BRENDA::Q1QT83 (391 letters) >FitnessBrowser__azobra:AZOBR_RS31370 Length = 398 Score = 449 bits (1155), Expect = e-131 Identities = 222/394 (56%), Positives = 280/394 (71%), Gaps = 6/394 (1%) Query: 1 MEHTWRWFGPDDPITLDEIRQTGATGIVTALHEIPNGEIWPEAAIAERKRLIEAS---GL 57 ME TWRWFGPDD I L+ IRQTGATGIVTALH+IP G +W I ERK +I A GL Sbjct: 1 MEQTWRWFGPDDVIRLNHIRQTGATGIVTALHQIPYGVVWSVEEIEERKAMIAADPSLGL 60 Query: 58 AWSVVESVPVHEDIKQGRGDCETHIARYQQTLRNLAACGIDVVCYNFMPVLDWTRTDLAW 117 WSVVES+PVHE IK G GD Y+Q+LRNLAACG+ VCYNFMP+LDWTRTDLA Sbjct: 61 RWSVVESLPVHESIKIGEGDLAPLFDNYRQSLRNLAACGVTTVCYNFMPILDWTRTDLAA 120 Query: 118 PLPGGGTALRFDQTAFAAFDLYLLERPGAEADYDATERDAARAYLDGLDESARQRLIDTI 177 P+PGGGT+LRF+ AAFD+++LERPGAE D+ ARA+ D E ++ L+ I Sbjct: 121 PVPGGGTSLRFNAHEHAAFDVFMLERPGAEDDHSPEVLARARAWFDKASEDDKKTLLANI 180 Query: 178 IAGLPGAEEHYSLARFREVIAEYAEIDAERLRDNLGHFLRAVVPVAEEVGIRLAIHPDDP 237 +AGLPGA + Y + R+++ Y ++ LR+ L FLR V+P AEEVGIR+ IHPDDP Sbjct: 181 MAGLPGAFDRYDIPGLRKMLDRYKDMSHGALRETLARFLREVIPTAEEVGIRMCIHPDDP 240 Query: 238 PRPLLGLPRVVSTPRDVQWILDAAPSPANGLTFCTGSYGVSAAIDLVAMGERFAERIYFA 297 PRPL+GLPR+VS D+ +I++ S ANG+TFCTGS G A D+ AM +RFA ++ FA Sbjct: 241 PRPLMGLPRIVSNEDDLDFIVNVIDSEANGITFCTGSLGAGAKNDVPAMIKRFAPKVTFA 300 Query: 298 HLRATQRENDPRSFHESAHLDGDVDMVGVIKALVGEERRRERDGGP--RLPLRPDHGHHL 355 HLR +++ D SF E+ HL GDVDMV V+ L+ E++RR+ G P R+P RPDHGH L Sbjct: 301 HLRNVKKDPD-GSFQEAEHLGGDVDMVSVVTTLLEEQKRRKDAGNPNWRIPFRPDHGHEL 359 Query: 356 LDDLSRDTRPGYPLIGRLKGLAELRGVETAIKQL 389 LDD+ + T PGYP IGRL+GLAE+RGV TA+ + Sbjct: 360 LDDVGKKTHPGYPAIGRLRGLAEIRGVMTAVASM 393 Lambda K H 0.321 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 488 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 398 Length adjustment: 31 Effective length of query: 360 Effective length of database: 367 Effective search space: 132120 Effective search space used: 132120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate AZOBR_RS31370 AZOBR_RS31370 (mannonate dehydratase)
to HMM TIGR00695 (uxuA: mannonate dehydratase (EC 4.2.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00695.hmm # target sequence database: /tmp/gapView.12096.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00695 [M=394] Accession: TIGR00695 Description: uxuA: mannonate dehydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-158 512.9 0.0 4e-158 512.6 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS31370 AZOBR_RS31370 mannonate dehydrat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS31370 AZOBR_RS31370 mannonate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 512.6 0.0 4e-158 4e-158 1 390 [. 1 393 [. 1 395 [. 0.98 Alignments for each domain: == domain 1 score: 512.6 bits; conditional E-value: 4e-158 TIGR00695 1 meqtfrwyGrndpvsledvrqaGakGivtalhhipnGevweveeikkrkeeie...daGlsasvvesvp 66 meqt+rw+G++d + l+++rq Ga+Givtalh+ip G vw+veei++rk++i + Gl +svves+p lcl|FitnessBrowser__azobra:AZOBR_RS31370 1 MEQTWRWFGPDDVIRLNHIRQTGATGIVTALHQIPYGVVWSVEEIEERKAMIAadpSLGLRWSVVESLP 69 9***************************************************744468*********** PP TIGR00695 67 vheeiklqteeyekyienykqtlrnlaqcGikvvcynfmpvldwtrtdlayeledGskalrfdkikvaa 135 vhe ik+++++ +ny+q+lrnla cG+ +vcynfmp+ldwtrtdla +++ G ++lrf+ + aa lcl|FitnessBrowser__azobra:AZOBR_RS31370 70 VHESIKIGEGDLAPLFDNYRQSLRNLAACGVTTVCYNFMPILDWTRTDLAAPVPGGGTSLRFNAHEHAA 138 ********************************************************************* PP TIGR00695 136 lelhilkrpdaekdyteeelvraveeasdmseedkarltrniiaglpGaeegekldrikelleaykdid 204 +++++l+rp+ae d++ e l+ra+ +++ se+dk l ni+aglpGa + + + +++ l++ykd++ lcl|FitnessBrowser__azobra:AZOBR_RS31370 139 FDVFMLERPGAEDDHSPEVLARARAWFDKASEDDKKTLLANIMAGLPGAFDRYDIPGLRKMLDRYKDMS 207 ********************************************************************* PP TIGR00695 205 eeklrenlafflkeilpvaeevGvkmaihpddpprpilGlprivstiedmkklveisdspangitlctG 273 + lre la fl+e++p aeevG++m ihpddpprp++Glprivs ++d+ +v++ ds angit+ctG lcl|FitnessBrowser__azobra:AZOBR_RS31370 208 HGALRETLARFLREVIPTAEEVGIRMCIHPDDPPRPLMGLPRIVSNEDDLDFIVNVIDSEANGITFCTG 276 ********************************************************************* PP TIGR00695 274 syGvradndlvelakqfadriyfahlrsvkreenpktfheaahlekdvdlyevvkavleeehrrkaeGk 342 s+G+ a+nd+ ++k+fa+++ fahlr+vk++ ++ +f+ea hl +dvd+ vv ++lee+ rrk G+ lcl|FitnessBrowser__azobra:AZOBR_RS31370 277 SLGAGAKNDVPAMIKRFAPKVTFAHLRNVKKDPDG-SFQEAEHLGGDVDMVSVVTTLLEEQKRRKDAGN 344 ********************************999.9*******************************9 PP TIGR00695 343 ed.lipvrpdhGrqllddlkkktnpGysaigrlkGlaelrGlelalkkv 390 + ip rpdhG++lldd+ kkt+pGy aigrl+Glae+rG+ +a+ + lcl|FitnessBrowser__azobra:AZOBR_RS31370 345 PNwRIPFRPDHGHELLDDVGKKTHPGYPAIGRLRGLAEIRGVMTAVASM 393 76369***************************************99776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (398 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.94 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory