GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gtrB in Azospirillum brasilense Sp245

Align GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter (characterized)
to candidate AZOBR_RS29760 AZOBR_RS29760 C4-dicarboxylate ABC transporter

Query= TCDB::P74224
         (445 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS29760 AZOBR_RS29760
           C4-dicarboxylate ABC transporter
          Length = 596

 Score =  251 bits (642), Expect = 3e-71
 Identities = 124/211 (58%), Positives = 161/211 (76%)

Query: 7   LGPMMFVGALVFLGCGYPVAFSLGGVAILFAIIGAALGSFDPIFLSAMPQRIFGIMANGT 66
           + P+MF   +  L  GYPVAF+L    +LF +IG  +G F P    A+P+R++G M N  
Sbjct: 1   MAPIMFATLVGMLLLGYPVAFALAANGLLFGLIGIEIGLFRPDLFQALPERVYGTMNNDV 60

Query: 67  LLAIPFFIFLGSMLERSGIAEQLLETMGIILGHLRGGLALAVILVGTMLAATTGVVAATV 126
           LLA+PFF F+G +LERSG+AE LL+T+G + G +RGGLA AVI VG +LAATTGVVAA+V
Sbjct: 61  LLAVPFFTFMGLVLERSGMAEDLLDTIGQLFGSIRGGLAYAVIFVGALLAATTGVVAASV 120

Query: 127 VAMGLISLPIMLRYGYSKELASGVIVASGTLGQIIPPSVVLIVLADQLGVSVGDLFIGSL 186
           ++MGLISLPIMLRYGY + LASGVI ASGTL QIIPPS+VLIV+ADQLG SVGD++  + 
Sbjct: 121 ISMGLISLPIMLRYGYDRRLASGVIAASGTLAQIIPPSLVLIVMADQLGRSVGDMYEAAF 180

Query: 187 LPGLMMAGSFALYVLIIAWLKPDLAPALPAE 217
           +PGL++AG +ALYV +++ + P  AP LP E
Sbjct: 181 IPGLLLAGLYALYVFVVSMIWPKAAPGLPPE 211



 Score =  224 bits (571), Expect = 6e-63
 Identities = 131/352 (37%), Positives = 205/352 (58%), Gaps = 36/352 (10%)

Query: 102 GGLALAVILVGTMLAATTGVVAATVVAMGLISLPIMLRYGYSKELASGVIVASGTLGQII 161
           G LAL    V T +   T V +     + L+S+ +++ +     LA+      G    ++
Sbjct: 228 GLLALFSGAVATWVMGRTDVKSGADYVVLLLSVAVLVAF-----LAAAFNRGFGAQRLVL 282

Query: 162 PPSVVLIVLADQLGVSVGDLFIGSLLPGLMMAGSFALYVLIIAWLKPDLAPALPAEVRNI 221
                  + A    ++V +    +L+   + AG  ALY L +A             V   
Sbjct: 283 QTVATAALTAAAAWLTVNEWTTLALIGDSIAAG--ALYALAVA------------VVERA 328

Query: 222 GGQELRRRIVQ----VMLPPLVLILLVLGSIFFGIASPTEAGAVGSIGAIALAHFNQRLN 277
            G+ L  R+ +    VM+PPL LI LVLG+IF G+A+PTE GA+G++GA+ALA   +RLN
Sbjct: 329 TGRRLISRMAEQATFVMVPPLALIFLVLGTIFIGLATPTEGGAMGAVGALALAAMKKRLN 388

Query: 278 WKALWEVCDATLRITSMVMLILLGSTAFSLVFRGLEGDRFMFDLLANLPGGQIGFLAISM 337
           +  + +   +T ++ + V+ IL+G+  FSL F G+ G  ++ +L+ +LPGGQ+GFL    
Sbjct: 389 FDMVRQATYSTAKLAAFVLFILIGARVFSLTFYGVNGHIWVEELMVSLPGGQMGFLIAVS 448

Query: 338 ITIFILGFFIDFFEIAFIVLPLFKPVAEALNLDLIWYGVIVGANLQTSFLTPPFGFALFY 397
           + +F+L FF+DFFE+AFIV+PL  P A+ L +DL+W+GVI+  N+QTSF+ PPFGF+LF+
Sbjct: 449 VMVFLLAFFLDFFELAFIVIPLLAPAADRLGIDLVWFGVILAVNMQTSFMHPPFGFSLFF 508

Query: 398 LRGVAP-------------ASLTTGQIYRGAVPFIGLQVLVLLLIIIFPALI 436
           LR VAP             A + T QIY GAVPF+ +Q++++ L+I FP ++
Sbjct: 509 LRSVAPKLPYIDRITKKETAPVLTSQIYWGAVPFVVIQLVMVALVIAFPQMV 560


Lambda     K      H
   0.331    0.148    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 788
Number of extensions: 43
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 2
Length of query: 445
Length of database: 596
Length adjustment: 35
Effective length of query: 410
Effective length of database: 561
Effective search space:   230010
Effective search space used:   230010
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory