Align alcohol dehydrogenase (EC 1.1.1.1); long-chain-alcohol dehydrogenase (EC 1.1.1.192) (characterized)
to candidate AZOBR_RS27605 AZOBR_RS27605 alcohol dehydrogenase
Query= BRENDA::A4IP64 (395 letters) >FitnessBrowser__azobra:AZOBR_RS27605 Length = 373 Score = 207 bits (528), Expect = 3e-58 Identities = 137/383 (35%), Positives = 202/383 (52%), Gaps = 19/383 (4%) Query: 6 IVFPPLSHVGWGALDQLVPEVKRLGAKHILVITDPM-LVKIGLVDQVTSPLRQEGYSVHV 64 +V PP G G + + + G LV+ D ++GL+D + V V Sbjct: 7 LVRPPRVLFGGGLVASVGAWARENGIARTLVVADAFNAARVGLLDLPGA--------VTV 58 Query: 65 YTDVVPEPPLETGEKAVAFARDGKFDLVIGVGGGSALDLAKLAAVLAVHDGSVADYLNLT 124 + V PEP + +A A + V+G GGGSA+DLAKLAAVL ++AD + Sbjct: 59 FDRVRPEPDTANLDDLLAVAEAAEPQFVVGFGGGSAMDLAKLAAVLPGSGQTLAD---VA 115 Query: 125 GTRTLEKKGLPKILIPTTSGTGSEVTNISVLSLETT--KDVVTHDYLLADVAIVDPQLTV 182 G + K +PTT+GTGSE ++++ T K V +LAD+A+VDP LT+ Sbjct: 116 GAERVRAKRAALAQVPTTAGTGSEAGTRALVTDPATASKIAVQSLRMLADLAVVDPDLTM 175 Query: 183 SVPPRVTAATGIDALTHAVEAYVSVNASPTSDGLAVAAIRLISRSLRKAVANGSDKQARI 242 +VP VTAATG+DAL H VEAY + A P D A+A IRLI R L +AVA+GSD++AR Sbjct: 176 TVPRAVTAATGVDALAHCVEAYTNRKAHPAIDLYALAGIRLIGRWLPRAVADGSDREARA 235 Query: 243 DMANGSYLAGLAFFNAGVAGVHALAYPLGGQFHIAHGESNAVLLPYVMGYIRQSCTKRMA 302 +A S G A HA+AYPLG + H+ HG +NA++ P+V+ + + ++ A Sbjct: 236 GLALASLYGGFCLGPVNTAAGHAVAYPLGTRHHVPHGAANALVFPHVLAFNAPAVPEKTA 295 Query: 303 DIFNALGGNSSFLSEVEASYRCVEELERFVADVGIPKTLGGFGIPESALESLTKDAVQQK 362 + ALG L V ++ + +G +L G+PE L + ++A + Sbjct: 296 GVLAALG-----LKPVREPAAVLQAAHGWCLALGCTMSLSDLGVPEDDLPRMAEEAHAIR 350 Query: 363 RLLARSPLPLLEADIRAIYEAAF 385 RLL +P P+ DI A+Y AA+ Sbjct: 351 RLLDNNPRPVGRDDILAMYRAAY 373 Lambda K H 0.318 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 373 Length adjustment: 30 Effective length of query: 365 Effective length of database: 343 Effective search space: 125195 Effective search space used: 125195 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory