Align GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate AZOBR_RS25595 AZOBR_RS25595 sugar ABC transporter ATP-binding protein
Query= TCDB::G3LHY8 (358 letters) >FitnessBrowser__azobra:AZOBR_RS25595 Length = 358 Score = 204 bits (520), Expect = 2e-57 Identities = 132/358 (36%), Positives = 183/358 (51%), Gaps = 14/358 (3%) Query: 4 LRNAAKMVGADYHIYPTDLVLERGTLNVLLGPTLAGKTSLMRLMAGLDRPTGGSIHFDGT 63 LR K G I+ DL + G +GP+ GK++L+RL+AGL+ P+GG + G Sbjct: 6 LRGVRKSFGRIEVIHGVDLEVADGEFVAFVGPSGCGKSTLLRLIAGLEEPSGGDLSIGGQ 65 Query: 64 DVTGMPVQKRNVAMVYQQFINYPALTVYNNIASPMRISGKDAATIDREVRKAAELLKLTP 123 V P R +AMV+Q + YP +T Y+N+A + +S D TI VR AA LL++ Sbjct: 66 RVNDRPPAARGIAMVFQSYALYPHMTAYDNMAFGLTLSRTDKGTIAERVRAAARLLQIED 125 Query: 124 YLDRTPLNLSGGQQQRTALARALVKNASLVLMDEPLANLDYKLREELREELPKIFAQSGA 183 LDR P +LSGGQ+QR A+ RA+V+ + L DEPL+NLD LR ++R E+ K+ A A Sbjct: 126 LLDRKPRDLSGGQRQRVAIGRAIVREPQVFLFDEPLSNLDAGLRVQMRLEIAKLKADLRA 185 Query: 184 IFVYATTEPSEALLLGGNTATLNQGRVTQFGPTIEVYRRPVNLATAGIFADPPLNTLDVT 243 +Y T + EA+ L LN GRV Q G +E+Y RP N AG P +N LDV Sbjct: 186 TMIYVTHDQVEAMTLADRIVVLNAGRVEQAGTPLELYHRPRNRFVAGFIGSPAMNFLDVV 245 Query: 244 KSGNV-----FTRPSGVTIPVPSHLAVVPDG-PVTIAFHPHHLGLAPQTGDAARLQARTL 297 G P GV + + A G P+T+ P H+GLA A L A L Sbjct: 246 SEGLTDGSVRVWLPGGVPLDIAVDGAAPAAGTPLTLGVRPEHVGLA---DGGAGLLATIL 302 Query: 298 VSEITGSESFVHLEY-DGVRWVMLAHGIHDIDPDMEVEAFL--DTRHLMAFGSDGRAI 352 E G E+ H DG R ++ G + + L +T HL FG DG+ + Sbjct: 303 AVERLGGETHCHAALEDGQRLLVRLDGDRPVAAGERLRLNLRGETAHL--FGPDGQRL 358 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 358 Length adjustment: 29 Effective length of query: 329 Effective length of database: 329 Effective search space: 108241 Effective search space used: 108241 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory