Align ABC transporter for L-Histidine, periplasmic substrate-binding component 2 (characterized)
to candidate AZOBR_RS00420 AZOBR_RS00420 hypothetical protein
Query= reanno::acidovorax_3H11:Ac3H11_2562 (321 letters) >FitnessBrowser__azobra:AZOBR_RS00420 Length = 316 Score = 282 bits (721), Expect = 9e-81 Identities = 151/313 (48%), Positives = 210/313 (67%), Gaps = 7/313 (2%) Query: 10 SLAAAAACVMALAAPAQAQDTKIVLGMSGWTGFAPLTLADKAGIFKKNGLDVEIKMIPQK 69 +LAAA A + A++A AQ TK+ + MSGWTGFAP+TLA + GIFKKNG++VEIK +P Sbjct: 10 ALAAAVAGLCAVSASAQ---TKVTVAMSGWTGFAPITLAKETGIFKKNGIEVEIKKMPTS 66 Query: 70 DRHLALASKSIQCAATTVETHVAWNANGVPIVQIFQMDKSYGADGIAVRGDIKSFADLKG 129 +RH A+A+ +Q TTV+TH+ + ++GV + Q+ +D S+G DGI VR + S ADLKG Sbjct: 67 NRHQAMAAGEVQAITTTVDTHLLYASSGVDVTQVLVLDSSHGGDGIVVRDAVNSLADLKG 126 Query: 130 KTIGVDAPGTAPYFGLAWMLSKNGMSLKDVKTTTLSPQAAAQAFVAGQNDAAMTYEPYLS 189 K + V G P F LA++L KNG+S+ +V+T L P AA AFVAGQ DAA+TYEPYLS Sbjct: 127 KQVAVQY-GGVPQFWLAYVLKKNGLSIGEVQTVNLQPSDAANAFVAGQFDAAVTYEPYLS 185 Query: 190 TVRDNPAAGKILATTLDYP-MVMDTVGCDPTWLKANGKAAQALANSYFQALDMIKADPAK 248 VR+ A GKI+ T+ P +++DT+ P +++ N K +A +S+F+ALD IK D K Sbjct: 186 KVRE--ANGKIIVTSDQTPGVIIDTLAFQPDYIQKNPKVVKAFVDSWFEALDEIKKDEKK 243 Query: 249 SNEIMGAAVKQTGEQFAKSSSFLRWQDKAANQKFFAGELTTFMKDATAILLEAGIIRKAN 308 + EIM V QT EQFA S+ + W DKA N ++ + TF+K+ ++LEA +IRKA Sbjct: 244 AFEIMARDVNQTPEQFATSAKTVLWYDKAGNVEYLTKTMPTFIKEVQDVMLEAKLIRKAP 303 Query: 309 EDLAVTFDASFIK 321 L DASF+K Sbjct: 304 PSLDSMTDASFVK 316 Lambda K H 0.317 0.129 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 316 Length adjustment: 27 Effective length of query: 294 Effective length of database: 289 Effective search space: 84966 Effective search space used: 84966 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory