Align Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale)
to candidate AZOBR_RS23520 AZOBR_RS23520 ABC transporter permease
Query= uniprot:B2TBJ8 (250 letters) >FitnessBrowser__azobra:AZOBR_RS23520 Length = 220 Score = 128 bits (322), Expect = 8e-35 Identities = 70/222 (31%), Positives = 126/222 (56%), Gaps = 10/222 (4%) Query: 4 DFDFLFDTIKQLLAAVPTTLGLFFCSLILGGLLSLVIVTMRVSP-HWLPNRFARAYILVF 62 DF ++ + +LL T+ + + +L +L L++ +R++P + A AY+ Sbjct: 4 DFAPVWGGLPELLKGTVVTIEVTAAAFLLSAVLGLLVGIIRLNPARRVLYGIASAYVAFI 63 Query: 63 RGSPLLIQMFLVYYGMGQFGVIRESFLWPVLREPYMCAVLSLALCTAGYTAEIIRGGLMA 122 RG+PLL+Q+FL+++G+ QFG++ + L C V+ L + + Y +E++RG + + Sbjct: 64 RGTPLLVQLFLLFFGLPQFGILLPAML---------CGVIGLGIYSGSYVSEVVRGAIQS 114 Query: 123 VPVGQIEAGYSIGLSGFALLRRVIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWEVTG 182 + GQ+EA S+G+S + V+ P A R+ LP E + L+K++AL SL+T+ +V Sbjct: 115 IDRGQMEAARSLGMSYREAMWEVVLPQAFRRMLPPLGNETIALIKNSALVSLLTIDDVMR 174 Query: 183 VAQQIIQQTYRTTEVFICAALIYLFLNFVIVRLLGMLETRLS 224 Q+II ++R EV+I ALIY L +L +E R++ Sbjct: 175 EGQRIISTSFRALEVYIAVALIYFVLTNAATWILRQIEKRMT 216 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 220 Length adjustment: 23 Effective length of query: 227 Effective length of database: 197 Effective search space: 44719 Effective search space used: 44719 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory